8T0S: Ubiquitin-conjugating enzyme E2 G2

Crystal structure of UBE2G2 adduct with phenethyl isothiocyanate (PEITC) at the Cys48 position. Determined by X-ray diffraction at 1.95 Å resolution. Released 5 Jun 2024.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,837
Mol. weight: 22.14 kDa
Released: 5 Jun 2024

Explore 8T0S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8T0S contains 10 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-18	15
α-helix	20-21	2
β-strand	24-28	5	1
β-strand	36-42	7	1
α-helix	43-44	2
β-strand	53-59	7	1
α-helix	68-69	2
β-strand	70-73	4	1
β-strand	82	1	2
β-strand	87	1	1
β-strand	88	1	2
α-helix	91-93	3
α-helix	108-110	3
α-helix	116-128	13
α-helix	138-146	9
α-helix	148-162	15

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	575-599	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-conjugating enzyme E2 G2	A	protein	165	Homo sapiens	P60604 (AlphaFold model)
E3 ubiquitin-protein ligase AMFR	B	protein	27	Homo sapiens	Q9UKV5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8T0S_1 Ubiquitin-conjugating enzyme E2 G2 (chains A)
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTXFEFGVFPAILSF
PLDYPLSPPKMRFTSEMFHPNIYPDGRVSISILHAPGDDPMGYESSAERWSPVQSVEKIL
LSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL

Sequence of entity 2 (B), FASTA

>8T0S_2 E3 ubiquitin-protein ligase AMFR (chains B)
SADERQRMLVQRKDELLQQARKRFLNK

Primary citation

Crystal structure of UBE2G2 adduct with phenethyl isothiocyanate (PEITC) at the Cys48 position. Wang, C., Shaw, G.X., Shi, G. et al. To be published.

Other PDB entries of the same protein (UniProt P60604 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LEW 1.74 Å, Crystal structure of UBE2G2 in complex with the UBE2G2-binding region of AUP1
3H8K 1.8 Å, Crystal structure of Ube2g2 complxed with the G2BR domain of gp78 at 1.8-A resolution
4LAD 2.3 Å, Crystal Structure of the Ube2g2:RING-G2BR complex
2CYX 2.56 Å, Structure of human ubiquitin-conjugating enzyme E2 G2 (UBE2G2/UBC7)
2KLY Solution structure of human ubiquitin conjugating enzyme Ube2g2
2LXP NMR structure of two domains in ubiquitin ligase gp78, RING and G2BR, bound to its…

Browse structure collections

About this viewer

MolViewer shows 8T0S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.