8T36: K49 acetylated LC3A

Crystal structure of K49 acetylated LC3A in complex with the LIR of TP53INP2/DOR. Determined by X-ray diffraction at 1.85 Å resolution. Released 22 May 2024.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,141
Mol. weight: 15.89 kDa
Released: 22 May 2024

Explore 8T36 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8T36 contains 9 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	-8--7	2	1
β-strand	-4--3	2	1
α-helix	-2--1	2
α-helix	2-4	3
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	2
α-helix	45-47	3
β-strand	51-55	5	2
β-strand	59	1	3
α-helix	60-70	11
β-strand	80-83	4	2
β-strand	86-87	2	2
β-strand	94	1	3
α-helix	95-102	8
α-helix	108	1
β-strand	109-114	6	2
α-helix	117-119	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor protein p53-inducible nuclear protein 2,Microtubule-associated proteins 1A/1B light chain 3A…	A	protein	134	Homo sapiens	Q8IXH6 (AlphaFold model), Q9H492 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8T36_1 Tumor protein p53-inducible nuclear protein 2,Microtubule-associated proteins 1A/1B light chain 3A chimera (chains A)
GSEDEVDGWLIIDMPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVL
DKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDG
FLYMVYASQETFGF

Primary citation

Structural and functional characterization of the role of acetylation on the interactions of the human Atg8-family proteins with the autophagy receptor TP53INP2/DOR. Ali, M.G., Wahba, H.M., Igelmann, S. et al. Autophagy (2024) 20:1948-1967. DOI 10.1080/15548627.2024.2353443 · PubMed

Other PDB entries of the same protein (UniProt Q8IXH6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8T33 1.6 Å, Crystal structure of K46 acetylated GABARAP in complex with the LIR of TP53INP2/DOR
7YO9 1.75 Å, Crystal structure of fusion protein of human TP53INP2 LIR and human GABARAP
8T35 1.9 Å, Crystal structure of K51 acetylated LC3A in complex with the LIR of TP53INP2/DOR
8T32 2.05 Å, Crystal structure of K48 acetylated GABARAP in complex with the LIR of TP53INP2/DOR
8T31 2.1 Å, Crystal structure of GABARAP in complex with the LIR of TP53INP2/DOR
8T4T 2.36 Å, Crystal structure of LC3A in complex with the LIR of TP53INP2/DOR

Browse structure collections

About this viewer

MolViewer shows 8T36 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.