RAG2-PHD finger in complex with H3K4tBuNle peptide. Determined by X-ray diffraction at 1.2 Å resolution. Released 14 Feb 2024.
Explore 8T4R in 3D Show helices and sheets RCSB PDB PDBe
8T4R contains 3 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 443-446 | 4 | 1 |
| β-strand | 452-455 | 4 | 1 |
| α-helix | 457-459 | 3 | |
| α-helix | 463-471 | 9 | |
| β-strand | 476 | 1 | 1 |
| α-helix | 482-486 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-4 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| V(D)J recombination-activating protein 2 | A | protein | 108 | Homo sapiens | P55895 (AlphaFold model) |
| H3 histone peptide | D | protein | 14 | Homo sapiens | Q6NXT2 (AlphaFold model) |
>8T4R_1 V(D)J recombination-activating protein 2 (chains A) MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSGYWITCCPTCDVDINTWVPFYSTELN KPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNEHVEIARA
>8T4R_2 H3 histone peptide (chains D) ARTXQTARKSTGGY
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Trimethyllysine Reader Proteins Exhibit Widespread Charge-Agnostic Binding via Different Mechanisms to Cationic and Neutral Ligands. Travis, C.R., Kean, K.M., Albanese, K.I. et al. J Am Chem Soc (2024) 146:3086-3093. DOI 10.1021/jacs.3c10031 · PubMed
MolViewer shows 8T4R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.