8TE4: DNA-methyltransferase 3A
Crystal structure of the methyltransferase domain of R882H/N879A DNMT3A homotetramer. Determined by X-ray diffraction at 2.65 Å resolution. Released 13 Mar 2024.
- Method
- X-ray diffraction
- Resolution
- 2.65 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 14,869
- Mol. weight
- 265.39 kDa
- Ligands
- SAH
- Released
- 13 Mar 2024
Explore 8TE4 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8TE4 contains 112 α-helices and 100 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 18 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 634-639 | 6 | 1 |
| α-helix | 645-652 | 8 | |
| β-strand | 655 | 1 | 2 |
| β-strand | 657-663 | 7 | 1 |
| α-helix | 667-676 | 10 | |
| β-strand | 682-683 | 2 | 1 |
| α-helix | 687-689 | 3 | |
| α-helix | 692-698 | 7 | |
| β-strand | 703-706 | 4 | 1 |
| β-strand | 714 | 1 | 3 |
| α-helix | 730-741 | 12 | |
| α-helix | 743-744 | 2 | |
| β-strand | 752-758 | 7 | 1 |
| β-strand | 761 | 1 | 3 |
| α-helix | 763-773 | 11 | |
| α-helix | 776-777 | 2 | |
| β-strand | 778-781 | 4 | 1 |
| α-helix | 782-784 | 3 | |
| β-strand | 788 | 1 | 4 |
| β-strand | 791-796 | 6 | 1 |
| α-helix | 804-806 | 3 | |
| α-helix | 815-818 | 4 | |
| α-helix | 820 | 1 | |
| β-strand | 823-825 | 3 | 5 |
| β-strand | 830 | 1 | 4 |
| β-strand | 850-852 | 3 | 5 |
| β-strand | 855-857 | 3 | 5 |
| α-helix | 861-868 | 8 | |
| α-helix | 870-871 | 2 | |
| α-helix | 882-890 | 9 | |
| α-helix | 893-894 | 2 | |
| α-helix | 895-902 | 8 | |
| α-helix | 903-907 | 5 | |
| β-strand | 911 | 1 | 2 |
Chain B: 19 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 634-639 | 6 | 6 |
| α-helix | 645-652 | 8 | |
| β-strand | 655 | 1 | 7 |
| β-strand | 657-663 | 7 | 6 |
| α-helix | 667-676 | 10 | |
| β-strand | 682-683 | 2 | 6 |
| α-helix | 687-689 | 3 | |
| α-helix | 692-698 | 7 | |
| β-strand | 703-706 | 4 | 6 |
| β-strand | 714 | 1 | 8 |
| α-helix | 730-741 | 12 | |
| α-helix | 743-744 | 2 | |
| β-strand | 752-758 | 7 | 6 |
| β-strand | 761 | 1 | 8 |
| α-helix | 763-773 | 11 | |
| α-helix | 776-777 | 2 | |
| β-strand | 778-781 | 4 | 6 |
| α-helix | 782-784 | 3 | |
| β-strand | 788 | 1 | 9 |
| β-strand | 791-796 | 6 | 6 |
| α-helix | 804-806 | 3 | |
| α-helix | 815-818 | 4 | |
| α-helix | 820 | 1 | |
| β-strand | 823-825 | 3 | 10 |
| β-strand | 830 | 1 | 9 |
| β-strand | 850-852 | 3 | 10 |
| β-strand | 855-857 | 3 | 10 |
| α-helix | 858-860 | 3 | |
| α-helix | 861-868 | 8 | |
| α-helix | 870-871 | 2 | |
| α-helix | 882-891 | 10 | |
| α-helix | 893-894 | 2 | |
| α-helix | 895-902 | 8 | |
| α-helix | 903-907 | 5 | |
| β-strand | 911 | 1 | 7 |
Chain C: 19 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 634-639 | 6 | 11 |
| α-helix | 645-652 | 8 | |
| β-strand | 655 | 1 | 12 |
| β-strand | 657-663 | 7 | 11 |
| α-helix | 667-676 | 10 | |
| β-strand | 682-683 | 2 | 11 |
| α-helix | 687-689 | 3 | |
| α-helix | 692-698 | 7 | |
| β-strand | 703-706 | 4 | 11 |
| β-strand | 714 | 1 | 13 |
| α-helix | 730-741 | 12 | |
| α-helix | 743-744 | 2 | |
| β-strand | 752-758 | 7 | 11 |
| β-strand | 761 | 1 | 13 |
| α-helix | 763-773 | 11 | |
| α-helix | 776-777 | 2 | |
| β-strand | 778-781 | 4 | 11 |
| α-helix | 782-784 | 3 | |
| β-strand | 788-789 | 2 | 14 |
| β-strand | 791-796 | 6 | 11 |
| α-helix | 804-806 | 3 | |
| α-helix | 815-818 | 4 | |
| α-helix | 820 | 1 | |
| β-strand | 823-825 | 3 | 15 |
| β-strand | 830-831 | 2 | 14 |
| β-strand | 850-852 | 3 | 15 |
| β-strand | 855-857 | 3 | 15 |
| α-helix | 858-860 | 3 | |
| α-helix | 861-868 | 8 | |
| α-helix | 870-871 | 2 | |
| α-helix | 882-890 | 9 | |
| α-helix | 893-894 | 2 | |
| α-helix | 895-902 | 8 | |
| α-helix | 903-907 | 5 | |
| β-strand | 911 | 1 | 12 |
Chain D: 19 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 634-639 | 6 | 22 |
| α-helix | 645-652 | 8 | |
| β-strand | 655 | 1 | 23 |
| β-strand | 657-663 | 7 | 22 |
| α-helix | 667-676 | 10 | |
| β-strand | 682-683 | 2 | 22 |
| α-helix | 687-689 | 3 | |
| α-helix | 692-698 | 7 | |
| β-strand | 703-706 | 4 | 22 |
| β-strand | 714 | 1 | 24 |
| α-helix | 730-741 | 12 | |
| α-helix | 743-744 | 2 | |
| β-strand | 752-758 | 7 | 22 |
| β-strand | 761 | 1 | 24 |
| α-helix | 763-773 | 11 | |
| α-helix | 776-777 | 2 | |
| β-strand | 778-781 | 4 | 22 |
| α-helix | 782-784 | 3 | |
| β-strand | 788 | 1 | 25 |
| β-strand | 791-796 | 6 | 22 |
| α-helix | 804-806 | 3 | |
| α-helix | 815-818 | 4 | |
| α-helix | 820 | 1 | |
| β-strand | 823-825 | 3 | 26 |
| β-strand | 830 | 1 | 25 |
| β-strand | 850-852 | 3 | 26 |
| β-strand | 855-857 | 3 | 26 |
| α-helix | 858-860 | 3 | |
| α-helix | 861-868 | 8 | |
| α-helix | 870-871 | 2 | |
| α-helix | 882-890 | 9 | |
| α-helix | 893-894 | 2 | |
| α-helix | 895-902 | 8 | |
| α-helix | 903-907 | 5 | |
| β-strand | 911 | 1 | 23 |
Chain E: 9 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 634-638 | 5 | 16 |
| α-helix | 645-652 | 8 | |
| β-strand | 655 | 1 | 17 |
| β-strand | 657-664 | 8 | 16 |
| β-strand | 681-686 | 6 | 16 |
| α-helix | 687-689 | 3 | |
| α-helix | 692-698 | 7 | |
| β-strand | 703-707 | 5 | 16 |
| α-helix | 730-741 | 12 | |
| α-helix | 743-744 | 2 | |
| β-strand | 752-758 | 7 | 16 |
| α-helix | 763-773 | 11 | |
| α-helix | 776-777 | 2 | |
| β-strand | 778-779 | 2 | 16 |
| β-strand | 792-796 | 5 | 16 |
| α-helix | 895-902 | 8 | |
| α-helix | 903-907 | 5 | |
| β-strand | 911 | 1 | 17 |
Chain F: 9 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 634-640 | 7 | 20 |
| α-helix | 645-652 | 8 | |
| β-strand | 655 | 1 | 21 |
| β-strand | 657-664 | 8 | 20 |
| β-strand | 681-686 | 6 | 20 |
| α-helix | 687-689 | 3 | |
| α-helix | 692-698 | 7 | |
| β-strand | 703-707 | 5 | 20 |
| α-helix | 728-741 | 14 | |
| α-helix | 743-744 | 2 | |
| β-strand | 752-758 | 7 | 20 |
| α-helix | 763-773 | 11 | |
| α-helix | 776-777 | 2 | |
| β-strand | 778-779 | 2 | 20 |
| β-strand | 792-796 | 5 | 20 |
| α-helix | 896-902 | 7 | |
| α-helix | 903-907 | 5 | |
| β-strand | 911 | 1 | 21 |
Chain G: 10 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 634-638 | 5 | 27 |
| α-helix | 645-652 | 8 | |
| β-strand | 655 | 1 | 28 |
| β-strand | 657-664 | 8 | 27 |
| β-strand | 681-686 | 6 | 27 |
| α-helix | 687-689 | 3 | |
| α-helix | 692-698 | 7 | |
| β-strand | 703-707 | 5 | 27 |
| α-helix | 728-741 | 14 | |
| α-helix | 743-744 | 2 | |
| β-strand | 752-758 | 7 | 27 |
| α-helix | 763-773 | 11 | |
| α-helix | 776-777 | 2 | |
| β-strand | 778-779 | 2 | 27 |
| β-strand | 792-796 | 5 | 27 |
| α-helix | 892-894 | 3 | |
| α-helix | 895-902 | 8 | |
| α-helix | 903-907 | 5 | |
| β-strand | 911 | 1 | 28 |
Chain H: 9 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 634-640 | 7 | 18 |
| α-helix | 645-652 | 8 | |
| β-strand | 655 | 1 | 19 |
| β-strand | 657-664 | 8 | 18 |
| β-strand | 681-686 | 6 | 18 |
| α-helix | 687-689 | 3 | |
| α-helix | 692-698 | 7 | |
| β-strand | 703-707 | 5 | 18 |
| α-helix | 728-741 | 14 | |
| α-helix | 743-744 | 2 | |
| β-strand | 752-758 | 7 | 18 |
| α-helix | 763-773 | 11 | |
| α-helix | 776-777 | 2 | |
| β-strand | 778-780 | 3 | 18 |
| β-strand | 792-796 | 5 | 18 |
| α-helix | 896-902 | 7 | |
| α-helix | 903-907 | 5 | |
| β-strand | 911 | 1 | 19 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA (cytosine-5)-methyltransferase 3A | A, B, C, D, E, F, G, H | protein | 287 | Homo sapiens | Q9Y6K1 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA
>8TE4_1 DNA (cytosine-5)-methyltransferase 3A (chains A, B, C, D, E, F, G, H)
GSAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVG
DVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKE
GDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPL
ASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEME
RVFGFPVHYTDVSAMSHLARQRLLGRSWSVPVIRHLFAPLKEYFACV
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| SAH | S-adenosyl-L-homocysteine | C14 H20 N6 O5 S | 4 |
Water and common crystallization additives (GOL) are not listed.
Primary citation
Structure-guided functional suppression of AML-associated DNMT3A hotspot mutations. Lu, J., Guo, Y., Yin, J. et al. Nat Commun (2024) 15:3111-3111. DOI 10.1038/s41467-024-47398-y · PubMed
Other PDB entries of the same protein (UniProt Q9Y6K1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8BA5 1.45 Å, Crystal structure of the DNMT3A ADD domain
- 4QBS 1.8 Å, Crystal structure of DNMT3a ADD domain E545R mutant bound to H3T3ph peptide
- 4QBR 1.9 Å, Crystal structure of DNMT3a ADD domain G550D mutant bound to H3 peptide
- 3A1B 2.29 Å, Crystal structure of the DNMT3A ADD domain in complex with histone H3
- 3A1A 2.3 Å, Crystal Structure of the DNMT3A ADD domain
- 3LLR 2.3 Å, Crystal structure of the PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 alpha
- 3SVM 2.31 Å, Human MPP8 - human DNMT3AK47me2 peptide
- 6W8B 2.4 Å, Structure of DNMT3A in complex with CGA DNA
- 4QBQ 2.41 Å, Crystal structure of DNMT3a ADD domain bound to H3 peptide
- 6W8J 2.44 Å, Structure of DNMT3A (R882H) in complex with CAG DNA
- 8TE1 2.48 Å, Crystal structure of the methyltransferase domain of R882H/R676K DNMT3A homotetramer
- 6W89 2.5 Å, Structure of DNMT3A (R882H) in complex with CGA DNA
Browse structure collections
About this viewer
MolViewer shows 8TE4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.