8TIO: Beta-arrestin-1

Human ACKR3 with C tail extended by 12 glycines phosphorylated by GRK5 in complex with Arrestin2 reconstructed without receptor/micelle. Determined by electron microscopy at 3.6 Å resolution. Released 22 Jan 2025.

Method: Electron microscopy
Resolution: 3.6 Å
Organisms: Bos taurus, synthetic construct, Homo sapiens
Chains: 4
Atoms: 5,591
Mol. weight: 142.29 kDa
Released: 22 Jan 2025

Explore 8TIO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TIO contains 11 α-helices and 66 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	19-22	4	1
β-strand	27-28	2	2
α-helix	35-36	2
β-strand	37-42	6	1
β-strand	53-62	10	3
β-strand	77-87	11	3
α-helix	99-108	10
β-strand	112-117	6	1
β-strand	127-129	3	3
β-strand	141-150	10	3
β-strand	163-168	6	3
β-strand	170-171	2	2
α-helix	173-175	3
α-helix	180-182	3
β-strand	183-186	4	4
β-strand	197-203	7	4
β-strand	207-209	3	5
α-helix	213	1
β-strand	214-222	9	4
β-strand	230-240	11	6
β-strand	241	1	7
β-strand	247	1	7
β-strand	251-258	8	6
β-strand	266-274	9	4
β-strand	288-290	3	3
β-strand	300	1	3
β-strand	318-328	11	6
β-strand	342-349	8	6
β-strand	350-352	3	5

Chain H: 1 helix, 20 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	8
β-strand	14-15	2	9
β-strand	20-28	9	8
β-strand	35-42	8	10
β-strand	50-55	6	10
β-strand	60-63	4	10
β-strand	71-76	6	8
β-strand	81-87	7	8
β-strand	95-103	9	10
β-strand	121-122	2	10
β-strand	126-128	3	10
β-strand	129-130	2	9
β-strand	139-143	5	11
β-strand	156-164	9	11
β-strand	170-173	4	12
β-strand	183-184	2	11
β-strand	188-189	2	11
β-strand	195-202	8	11
β-strand	213-219	7	12
α-helix	220-222	3
β-strand	224-230	7	12

Chain L: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	13
β-strand	11-14	4	14
β-strand	20-26	7	13
β-strand	35-39	5	14
α-helix	44-45	2
β-strand	49-50	2	14
β-strand	54-55	2	14
β-strand	63-66	4	13
β-strand	71-76	6	13
β-strand	86-91	6	14
α-helix	97	1
β-strand	98-99	2	14
β-strand	104-107	4	14
β-strand	112	1	15
β-strand	115-119	5	16
α-helix	120-122	3
α-helix	123-128	6
β-strand	130-140	11	16
β-strand	141	1	15
β-strand	145-150	6	17
β-strand	160-163	4	16
β-strand	174-183	10	16
α-helix	184-187	4
β-strand	192-199	8	17
β-strand	206-211	6	17

Chain R: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	353-356	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A	protein	418	Bos taurus	A0A4W2IM57 (AlphaFold model)
Fab7 heavy chain	H	protein	240	synthetic construct
Fab7 light chain	L	protein	215	Bos taurus
Atypical chemokine receptor 3	R	protein	405	Homo sapiens	P25106 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8TIO_1 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPEHETPVDTNLIELDTNDDDAAAEDFARQRLKGMKDDKEEEEDGTGSPRLNDR

Sequence of entity 2 (H), FASTA

>8TIO_2 Fab7 heavy chain (chains H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVSSSYIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARKSMYHRGWGWLSWVYGAMD
YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

Sequence of entity 3 (L), FASTA

>8TIO_3 Fab7 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYYYPITFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (R), FASTA

>8TIO_4 Atypical chemokine receptor 3 (chains R)
GAPDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIG
MIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCK
VTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLP
DTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARA
ISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALH
VTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYGGGGGGGGGGGGSAKTGLTKLIDA
SRVSETEYSALEQSTKGRPLEVLFQGPHHHHHHHHHHDYKDDDDK

Primary citation

Effect of phosphorylation barcodes on arrestin binding to a chemokine receptor. Chen, Q., Schafer, C.T., Mukherjee, S. et al. Nature (2025) 643:280-287. DOI 10.1038/s41586-025-09024-9 · PubMed

Browse structure collections

About this viewer

MolViewer shows 8TIO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.