8TO6: DNA-directed RNA polymerase subunit alpha

Escherichia coli RNA polymerase unwinding intermediate (I1d) at the lambda PR promoter. Determined by electron microscopy at 2.9 Å resolution. Released 3 Jul 2024.

Method: Electron microscopy
Resolution: 2.9 Å
Organisms: Escherichia coli (strain K12), Escherichia phage Lambda
Chains: 9
Atoms: 31,406
Mol. weight: 562.54 kDa
Ligands: MG, 4QM, ZN
Released: 3 Jul 2024

Explore 8TO6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TO6 contains 168 α-helices and 212 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	13-17	5	1
β-strand	23-31	9	1
α-helix	35-49	15
β-strand	52-53	2	2
β-strand	56-61	6	3
β-strand	74	1	4
α-helix	78-86	9
β-strand	90-92	3	5
β-strand	97-105	9	3
β-strand	108-111	4	4
α-helix	112-114	3
β-strand	115-116	2	3
α-helix	117	1
β-strand	121-123	3	5
β-strand	129-133	5	4
β-strand	139-147	9	3
β-strand	149-150	2	2
β-strand	151-153	3	6
α-helix	155-158	4
β-strand	171-172	2	3
β-strand	175-177	3	6
β-strand	180-189	10	1
β-strand	199-207	9	1
α-helix	213-232	20

Chain H: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	16-20	5	7
β-strand	23-26	4	7
β-strand	28-31	4	8
α-helix	35-49	15
β-strand	52-61	10	9
α-helix	78-86	9
β-strand	98-105	8	9
β-strand	109-110	2	10
α-helix	112-114	3
α-helix	116-117	2
β-strand	131-132	2	10
β-strand	139-150	12	9
β-strand	152-153	2	11
β-strand	171-172	2	9
β-strand	175-176	2	11
β-strand	180-184	5	7
β-strand	187-190	4	8
β-strand	198-201	4	8
β-strand	204-207	4	7
α-helix	213-228	16

Chain I: 57 helices, 97 β-strands

Element	Residues	Length	Sheet
β-strand	13-14	2	12
α-helix	29-36	8
α-helix	49-56	8
β-strand	59-60	2	13
α-helix	61	1
α-helix	62-64	3
β-strand	66-75	10	13
α-helix	82-88	7
β-strand	93-104	12	13
β-strand	116-128	13	13
β-strand	130	1	14
β-strand	136-137	2	14
β-strand	142-145	4	14
β-strand	147-151	5	15
α-helix	152	1
β-strand	154-159	6	16
β-strand	172-177	6	16
β-strand	180	1	17
β-strand	184-188	5	16
β-strand	194-197	4	16
β-strand	204-205	2	16
α-helix	207-212	6
α-helix	217-224	8
β-strand	226-231	6	18
β-strand	238-240	3	18
α-helix	243-245	3
α-helix	268-269	2
α-helix	271-280	10
β-strand	284-286	3	18
α-helix	289-292	4
β-strand	296	1	19
β-strand	297	1	18
β-strand	301-303	3	20
β-strand	308-311	4	20
β-strand	316	1	19
α-helix	319-327	9
β-strand	333-337	5	18
α-helix	346-353	8
α-helix	359-370	12
α-helix	375-376	2
α-helix	378-388	11
β-strand	396	1	17
α-helix	399-408	10
α-helix	422-437	16
α-helix	442-444	3
β-strand	451-454	4	15
α-helix	456-480	25
α-helix	496-507	12
β-strand	512-514	3	14
α-helix	515-516	2
α-helix	520-527	8
β-strand	529-531	3	15
α-helix	552-554	3
β-strand	558	1	21
β-strand	572-574	3	15
β-strand	575	1	21
β-strand	580-581	2	22
β-strand	587-594	8	22
β-strand	598	1	23
β-strand	599-607	9	22
α-helix	610-613	4
β-strand	616-617	2	22
β-strand	623	1	24
β-strand	628	1	23
β-strand	629	1	24
β-strand	633-637	5	22
β-strand	642-646	5	22
α-helix	647-649	3
β-strand	652-654	3	22
α-helix	671-673	3
β-strand	674	1	25
α-helix	676-686	11
β-strand	689	1	26
α-helix	690-691	2
β-strand	700-701	2	12
α-helix	705-711	7
β-strand	716-717	2	27
β-strand	722-727	6	28
β-strand	731-736	6	28
α-helix	738-740	3
β-strand	748-752	5	28
β-strand	757-758	2	29
β-strand	763	1	30
β-strand	764-765	2	29
β-strand	768-769	2	27
β-strand	776-777	2	28
β-strand	782-785	4	27
β-strand	789-790	2	31
β-strand	793-794	2	31
β-strand	798-804	7	32
β-strand	816-819	4	32
α-helix	821-824	4
β-strand	830-841	12	30
β-strand	842-843	2	33
β-strand	846-847	2	33
β-strand	849-850	2	34
β-strand	865	1	35
β-strand	870	1	36
β-strand	871	1	35
α-helix	872	1
β-strand	876	1	30
β-strand	882-884	3	36
β-strand	886-887	2	34
β-strand	889	1	37
α-helix	899-906	8
α-helix	908-910	3
β-strand	913	1	37
β-strand	918-919	2	36
α-helix	920-921	2
β-strand	927-935	9	30
α-helix	943-977	35
α-helix	987-989	3
α-helix	1011-1037	27
α-helix	1039-1040	2
α-helix	1042-1043	2
β-strand	1046-1058	13	30
β-strand	1065-1067	3	38
β-strand	1073-1075	3	38
β-strand	1076-1080	5	32
α-helix	1082-1084	3
β-strand	1087-1088	2	39
β-strand	1093	1	39
β-strand	1096-1098	3	32
α-helix	1100-1102	3
β-strand	1108	1	25
α-helix	1110-1133	24
α-helix	1138-1148	11
α-helix	1161-1163	3
α-helix	1166-1175	10
β-strand	1182-1183	2	12
α-helix	1192-1201	10
β-strand	1209-1210	2	32
β-strand	1212-1213	2	39
α-helix	1219	1
β-strand	1220	1	39
α-helix	1221	1
β-strand	1225-1232	8	32
β-strand	1233-1234	2	38
β-strand	1235	1	26
α-helix	1239-1241	3
β-strand	1244-1246	3	40
β-strand	1251	1	41
β-strand	1252	1	42
β-strand	1258	1	41
β-strand	1260	1	43
β-strand	1267	1	43
β-strand	1268-1269	2	44
α-helix	1272-1280	9
α-helix	1284-1288	5
α-helix	1289-1293	5
α-helix	1298-1309	12
α-helix	1321-1331	11
β-strand	1335	1	45
β-strand	1338-1340	3	46

Chain J: 61 helices, 76 β-strands

Element	Residues	Length	Sheet
β-strand	19-21	3	46
β-strand	24	1	45
α-helix	27-33	7
β-strand	34-37	4	47
β-strand	44	1	48
β-strand	51	1	48
α-helix	59-62	4
α-helix	78-80	3
α-helix	83	1
β-strand	84	1	49
α-helix	85	1
β-strand	91	1	49
α-helix	95-99	5
β-strand	102-112	11	47
α-helix	115-118	4
α-helix	123-128	6
α-helix	132-139	8
β-strand	144-146	3	50
β-strand	159-160	2	50
α-helix	162-169	8
β-strand	178-179	2	50
α-helix	182-191	10
α-helix	194-206	13
α-helix	211-230	20
α-helix	234-237	4
β-strand	238-244	7	47
α-helix	247-249	3
β-strand	252-255	4	51
β-strand	259-262	4	51
α-helix	264-284	21
α-helix	289-307	19
α-helix	315-316	2
β-strand	317	1	52
β-strand	323	1	52
α-helix	324-325	2
α-helix	328-330	3
α-helix	337-342	6
β-strand	346-347	2	44
β-strand	350-356	7	40
β-strand	365-369	5	40
α-helix	370-376	7
α-helix	378-387	10
α-helix	394-403	10
α-helix	406-415	10
β-strand	421-424	4	40
α-helix	431-433	3
β-strand	434-442	9	40
β-strand	446-448	3	40
α-helix	451-453	3
α-helix	454-457	4
β-strand	465-469	5	40
α-helix	474-482	9
β-strand	485	1	40
β-strand	491	1	53
β-strand	498	1	53
α-helix	505-513	9
β-strand	526-527	2	54
α-helix	530-538	9
β-strand	547-556	10	54
β-strand	564-573	10	54
α-helix	574-579	6
α-helix	589-591	3
α-helix	598-611	14
α-helix	615-635	21
α-helix	650-669	20
α-helix	675-701	27
β-strand	703-706	4	55
β-strand	714-717	4	55
α-helix	721-727	7
α-helix	736-741	6
β-strand	745	1	56
β-strand	748	1	57
β-strand	754	1	57
β-strand	759	1	56
α-helix	771-804	34
β-strand	809-811	3	58
β-strand	820-822	3	59
β-strand	825-826	2	60
β-strand	831-833	3	60
α-helix	835-839	5
β-strand	843	1	61
β-strand	844	1	59
β-strand	848-849	2	62
β-strand	856-858	3	62
β-strand	863	1	61
α-helix	866-875	10
β-strand	880-882	3	59
α-helix	885-887	3
β-strand	894-895	2	58
α-helix	896-899	4
β-strand	901	1	63
β-strand	908	1	63
α-helix	909-910	2
α-helix	915-924	10
α-helix	925-929	5
β-strand	957-961	5	64
β-strand	965-967	3	65
β-strand	973-975	3	65
β-strand	980-985	6	64
β-strand	991-997	7	64
β-strand	1001-1003	3	65
β-strand	1010	1	64
β-strand	1019-1020	2	65
β-strand	1028	1	66
β-strand	1033-1036	4	67
β-strand	1046-1051	6	68
β-strand	1056-1061	6	68
α-helix	1062-1063	2
β-strand	1079-1081	3	67
β-strand	1087	1	67
β-strand	1106-1107	2	68
α-helix	1110	1
β-strand	1113-1115	3	67
β-strand	1120	1	66
β-strand	1122	1	68
α-helix	1137-1145	9
α-helix	1148-1150	3
α-helix	1153-1155	3
β-strand	1156	1	69
β-strand	1161-1165	5	70
β-strand	1173-1178	6	70
β-strand	1187-1190	4	70
β-strand	1203-1204	2	70
β-strand	1209	1	69
α-helix	1217-1223	7
α-helix	1226-1243	18
α-helix	1250-1260	11
β-strand	1263-1266	4	71
β-strand	1279-1281	3	71
α-helix	1282-1294	13
β-strand	1302-1304	3	71
α-helix	1309-1312	4
α-helix	1319-1325	7
α-helix	1328-1338	11
β-strand	1341-1342	2	46
α-helix	1349-1353	5
α-helix	1363-1374	12

Chain K: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-13	7
α-helix	16-28	13
α-helix	29-34	6
α-helix	46-55	10
α-helix	61-73	13

Chain L: 27 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	97-106	10
α-helix	109-111	3
α-helix	113-135	23
α-helix	138-152	15
α-helix	158-161	4
β-strand	165	1	72
α-helix	214-232	19
α-helix	243-257	15
β-strand	259	1	72
α-helix	263-292	30
α-helix	299-305	7
α-helix	314-317	4
α-helix	319-321	3
α-helix	325-329	5
α-helix	334-351	18
α-helix	355-392	38
α-helix	401-417	17
α-helix	427-446	20
α-helix	454-474	21
α-helix	480-486	7
α-helix	493-499	7
α-helix	504	1
β-strand	505-506	2	51
α-helix	519-522	4
β-strand	524	1	42
α-helix	528-530	3
α-helix	531-550	20
α-helix	553-562	10
α-helix	573-580	8
α-helix	588-599	12
α-helix	606-610	5

Chain M: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	251-254	4
β-strand	256	1	73
α-helix	257-260	4
α-helix	264-273	10
β-strand	277	1	73
α-helix	278-282	5
α-helix	286-291	6
α-helix	297-309	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit alpha	G, H, M	protein	329	Escherichia coli (strain K12)	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	I	protein	1342	Escherichia coli (strain K12)	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	J	protein	1407	Escherichia coli (strain K12)	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	K	protein	91	Escherichia coli (strain K12)	P0A800 (AlphaFold model)
RNA polymerase sigma factor RpoD	L	protein	613	Escherichia coli (strain K12)	P00579
Nontemplate strand of lamdba PR promoter DNA	O	DNA	105	Escherichia phage Lambda
Template strand of lamdba PR promoter DNA	P	DNA	105	Escherichia phage Lambda

Sequence of entity 1 (G, H, M), FASTA

>8TO6_1 DNA-directed RNA polymerase subunit alpha (chains G, H, M)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 2 (I), FASTA

>8TO6_2 DNA-directed RNA polymerase subunit beta (chains I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 3 (J), FASTA

>8TO6_3 DNA-directed RNA polymerase subunit beta' (chains J)
MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNE

Sequence of entity 4 (K), FASTA

>8TO6_4 DNA-directed RNA polymerase subunit omega (chains K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 5 (L), FASTA

>8TO6_5 RNA polymerase sigma factor RpoD (chains L)
MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAP
DADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIA
KRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATH
VGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGR
SHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKK
NFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKD
INRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFE
YRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTP
EELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESL
RAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRH
PSRSEVLRSFLDD

Sequence of entity 6 (O), FASTA

>8TO6_6 Nontemplate strand of lamdba PR promoter DNA (chains O)
CGGAATCGAGGGATCCTCTAGAGTTGGATAAATATCTAACACCGTGCGTGTTGACTATTT
TACCTCTGGCGGTGATAATGGTTGCATGTACTAAGGAGGTTGTCG

Sequence of entity 7 (P), FASTA

>8TO6_7 Template strand of lamdba PR promoter DNA (chains P)
CGACAACCTCCTTAGTACATGCAACCATTATCACCGCCAGAGGTAAAATAGTCAACACGC
ACGGTGTTAGATATTTATCCAACTCTAGAGGATCCCTCGATTCCG

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
4QM	(3R,5S,7R,8R,9S,10S,12S,13R,14S,17R)-10,13-dimethyl-17-[(2R)-pentan-2-yl]-2,3,4…	C24 H42 O3	3
ZN	Zinc ion	Zn	2

Primary citation

Early intermediates in bacterial RNA polymerase promoter melting visualized by time-resolved cryo-electron microscopy. Saecker, R.M., Mueller, A.U., Malone, B. et al. Nat Struct Mol Biol (2024) 31:1778-1788. DOI 10.1038/s41594-024-01349-9 · PubMed

Other PDB entries of the same protein (UniProt P0A7Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K4G 2.05 Å, Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
1BDF 2.5 Å, Structure of escherichia coli RNA polymerase alpha subunit N-terminal domain
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 8TO6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.