8TO8: DNA-directed RNA polymerase subunit alpha

Escherichia coli RNA polymerase unwinding intermediate (I1b) at the lambda PR promoter. Determined by electron microscopy at 2.9 Å resolution. Released 3 Jul 2024.

Method: Electron microscopy
Resolution: 2.9 Å
Organisms: Escherichia coli (strain K12), Escherichia coli K-12, Escherichia phage Lambda
Chains: 9
Atoms: 31,131
Mol. weight: 562.92 kDa
Ligands: MG, 4QM, ZN
Released: 3 Jul 2024

Explore 8TO8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TO8 contains 172 α-helices and 222 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	13-15	3	1
β-strand	18	1	1
β-strand	23-31	9	1
α-helix	35-49	15
β-strand	52-53	2	2
β-strand	56-61	6	3
β-strand	74	1	4
α-helix	78-86	9
β-strand	90-92	3	5
β-strand	97-105	9	3
β-strand	108-111	4	4
α-helix	112-114	3
β-strand	115-116	2	3
α-helix	117	1
β-strand	121-123	3	5
β-strand	129-133	5	4
β-strand	139-147	9	3
β-strand	149-150	2	2
β-strand	151-153	3	6
α-helix	155-158	4
β-strand	171-172	2	3
β-strand	175-177	3	6
β-strand	180-189	10	1
β-strand	199-207	9	1
α-helix	213-232	20

Chain H: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	14-20	7	7
β-strand	23-31	9	7
α-helix	35-49	15
β-strand	53-61	9	8
α-helix	77	1
α-helix	81-86	6
β-strand	90	1	9
β-strand	97-105	9	8
β-strand	109-111	3	10
α-helix	112-114	3
α-helix	116-117	2
β-strand	123	1	9
β-strand	129-132	4	10
β-strand	139-149	11	8
β-strand	152-153	2	11
β-strand	171-172	2	8
β-strand	175-176	2	11
β-strand	180-184	5	7
β-strand	187-190	4	7
β-strand	198-201	4	7
β-strand	204-207	4	7
α-helix	213-227	15

Chain I: 59 helices, 95 β-strands

Element	Residues	Length	Sheet
α-helix	11-12	2
β-strand	13-14	2	12
α-helix	30-38	9
α-helix	49-56	8
α-helix	57	1
β-strand	59-60	2	13
α-helix	62-64	3
β-strand	66-75	10	13
α-helix	76-78	3
α-helix	82-88	7
β-strand	93-106	14	13
β-strand	109-128	20	13
α-helix	129	1
β-strand	130	1	14
α-helix	131	1
β-strand	136-137	2	14
β-strand	142-145	4	14
β-strand	147-151	5	15
α-helix	152	1
β-strand	154-159	6	16
β-strand	172-177	6	16
β-strand	180	1	17
β-strand	184-187	4	16
β-strand	195-198	4	16
β-strand	204-205	2	16
α-helix	207-212	6
α-helix	217-224	8
β-strand	226-229	4	18
β-strand	231	1	19
β-strand	238-239	2	19
α-helix	268-269	2
α-helix	271-280	10
β-strand	285-286	2	19
α-helix	289-292	4
β-strand	296-297	2	18
β-strand	301-303	3	20
β-strand	308-311	4	20
β-strand	315-316	2	18
α-helix	319-327	9
β-strand	334-337	4	18
α-helix	347-353	7
α-helix	359-370	12
α-helix	378-388	11
β-strand	396	1	17
α-helix	399-408	10
α-helix	422-437	16
β-strand	451-454	4	15
α-helix	456-479	24
α-helix	495-507	13
β-strand	512-514	3	14
α-helix	515-516	2
α-helix	520-527	8
β-strand	529-531	3	15
β-strand	539	1	21
β-strand	542	1	21
α-helix	552-554	3
β-strand	558	1	22
β-strand	572-574	3	15
β-strand	575	1	22
β-strand	580-581	2	23
β-strand	587-594	8	23
β-strand	598	1	24
β-strand	599-607	9	23
α-helix	608-611	4
β-strand	616-617	2	23
β-strand	623	1	25
β-strand	628	1	24
β-strand	629	1	25
β-strand	633-637	5	23
β-strand	642-646	5	23
β-strand	652-654	3	23
α-helix	665-667	3
α-helix	671-673	3
β-strand	674	1	26
α-helix	676-686	11
β-strand	689	1	27
α-helix	690-691	2
β-strand	700-701	2	12
α-helix	705-712	8
β-strand	716-717	2	28
β-strand	722-728	7	29
β-strand	731-736	6	29
α-helix	738-740	3
β-strand	748-752	5	29
α-helix	753-754	2
β-strand	757-758	2	30
β-strand	764-765	2	30
β-strand	768-769	2	28
β-strand	776-777	2	29
β-strand	782-785	4	28
β-strand	789-790	2	31
β-strand	793-794	2	31
β-strand	798-804	7	32
β-strand	815-819	5	32
α-helix	821-824	4
β-strand	830-841	12	33
β-strand	842-843	2	34
β-strand	846-847	2	34
β-strand	849-850	2	35
β-strand	865	1	36
β-strand	870	1	37
β-strand	871	1	36
α-helix	872	1
β-strand	876-878	3	33
β-strand	882-884	3	37
β-strand	886-887	2	35
β-strand	889	1	38
α-helix	894-896	3
α-helix	899-906	8
β-strand	913	1	38
β-strand	918-919	2	37
α-helix	920-921	2
β-strand	925-935	11	33
α-helix	943-978	36
α-helix	994-999	6
α-helix	1006-1036	31
α-helix	1042-1043	2
β-strand	1046-1058	13	33
α-helix	1059-1060	2
β-strand	1065-1067	3	32
β-strand	1073-1080	8	32
α-helix	1082-1084	3
β-strand	1087	1	39
β-strand	1093	1	39
β-strand	1096-1098	3	32
α-helix	1102-1105	4
β-strand	1108	1	26
α-helix	1110-1133	24
α-helix	1138-1149	12
α-helix	1161-1163	3
α-helix	1166-1175	10
β-strand	1182-1183	2	12
α-helix	1192-1201	10
β-strand	1209-1210	2	32
β-strand	1213	1	39
α-helix	1219	1
β-strand	1220	1	39
α-helix	1221	1
β-strand	1225-1234	10	32
β-strand	1235	1	27
α-helix	1239-1241	3
β-strand	1244-1246	3	40
β-strand	1251	1	41
β-strand	1252	1	42
β-strand	1258	1	41
β-strand	1260	1	43
β-strand	1267	1	43
β-strand	1268-1270	3	44
α-helix	1272-1280	9
α-helix	1284-1288	5
α-helix	1289-1293	5
α-helix	1298-1308	11
α-helix	1321-1332	12
β-strand	1335-1338	4	45

Chain J: 58 helices, 84 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	45
α-helix	25-26	2
α-helix	27-33	7
β-strand	34-37	4	46
β-strand	44	1	47
β-strand	51	1	47
β-strand	52	1	48
β-strand	58	1	48
α-helix	59-62	4
β-strand	84	1	49
β-strand	91	1	49
α-helix	95-99	5
β-strand	102-112	11	46
α-helix	114-116	3
α-helix	123-128	6
α-helix	132-139	8
β-strand	143-146	4	50
β-strand	159-161	3	50
α-helix	162-169	8
β-strand	178-179	2	50
α-helix	182-191	10
α-helix	194-206	13
α-helix	213-230	18
α-helix	234-237	4
β-strand	238-244	7	46
α-helix	247-249	3
β-strand	252-254	3	51
α-helix	255	1
β-strand	260-262	3	51
α-helix	264-282	19
α-helix	289-307	19
β-strand	317	1	52
β-strand	323	1	52
α-helix	324-325	2
α-helix	328-330	3
α-helix	337-341	5
β-strand	345-347	3	44
β-strand	350-354	5	40
β-strand	355-356	2	53
β-strand	365-369	5	53
α-helix	370-376	7
α-helix	378-387	10
α-helix	394-403	10
α-helix	406-416	11
β-strand	421-424	4	40
α-helix	431-433	3
β-strand	434-437	4	40
β-strand	438-442	5	53
β-strand	447-448	2	53
α-helix	451-453	3
α-helix	454-457	4
β-strand	465-469	5	40
α-helix	474-482	9
β-strand	485	1	40
β-strand	491	1	54
β-strand	498	1	54
α-helix	505-513	9
β-strand	526-527	2	55
α-helix	530-538	9
β-strand	547-556	10	55
β-strand	564-573	10	55
α-helix	574-579	6
α-helix	598-611	14
α-helix	615-635	21
α-helix	650-669	20
α-helix	675-701	27
β-strand	703-706	4	56
β-strand	714-717	4	56
α-helix	721-727	7
α-helix	734-741	8
β-strand	745	1	57
β-strand	748	1	58
β-strand	754	1	58
β-strand	759	1	57
α-helix	766-767	2
α-helix	769-803	35
β-strand	809	1	59
β-strand	820-822	3	60
β-strand	825-826	2	61
β-strand	831-833	3	61
α-helix	835-839	5
β-strand	843	1	62
β-strand	844	1	60
β-strand	849	1	63
β-strand	856	1	63
β-strand	863	1	62
α-helix	866-875	10
β-strand	880-882	3	60
α-helix	885-887	3
β-strand	894	1	59
α-helix	896-899	4
β-strand	901	1	64
β-strand	908	1	64
α-helix	909-910	2
α-helix	915-924	10
α-helix	925-927	3
β-strand	949-950	2	65
β-strand	957-961	5	66
β-strand	965-967	3	65
β-strand	973-975	3	65
β-strand	981-985	5	66
β-strand	991-996	6	66
β-strand	1002-1003	2	65
β-strand	1010	1	66
β-strand	1018-1019	2	65
β-strand	1033	1	67
β-strand	1034-1038	5	68
β-strand	1046-1050	5	69
β-strand	1057-1061	5	69
β-strand	1077-1081	5	68
β-strand	1087-1088	2	68
β-strand	1089	1	70
β-strand	1096	1	70
β-strand	1105-1107	3	69
α-helix	1110	1
β-strand	1115	1	67
β-strand	1122	1	69
α-helix	1138-1145	8
α-helix	1153-1155	3
β-strand	1156	1	71
β-strand	1161	1	72
β-strand	1162-1165	4	73
β-strand	1170	1	74
β-strand	1172	1	74
β-strand	1173-1178	6	73
β-strand	1187-1190	4	73
β-strand	1204	1	72
β-strand	1209	1	71
α-helix	1214-1216	3
α-helix	1217-1223	7
α-helix	1226-1236	11
α-helix	1238-1243	6
α-helix	1251-1260	10
β-strand	1263-1268	6	75
β-strand	1279-1281	3	75
α-helix	1282-1294	13
β-strand	1301-1305	5	75
α-helix	1319-1325	7
α-helix	1328-1337	10
β-strand	1341-1342	2	45
α-helix	1347-1353	7
α-helix	1363-1374	12

Chain K: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	8-13	6
α-helix	16-28	13
α-helix	29-34	6
α-helix	46-56	11
α-helix	61-75	15

Chain L: 32 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
α-helix	24-30	7
α-helix	39-48	10
α-helix	78-82	5
α-helix	97-106	10
α-helix	113-134	22
α-helix	138-150	13
α-helix	151-155	5
α-helix	158-161	4
β-strand	165	1	76
α-helix	217-232	16
α-helix	242-257	16
β-strand	259	1	76
α-helix	263-288	26
α-helix	289-293	5
α-helix	299-306	8
α-helix	318-321	4
α-helix	325-329	5
α-helix	334-351	18
α-helix	355-390	36
α-helix	401-417	17
α-helix	427-430	4
α-helix	432-445	14
α-helix	454-474	21
α-helix	480-487	8
α-helix	493-498	6
α-helix	504	1
β-strand	505-506	2	51
β-strand	510	1	77
β-strand	518	1	77
α-helix	519-522	4
β-strand	524	1	42
α-helix	529-530	2
α-helix	531-548	18
α-helix	553-562	10
α-helix	573-580	8
α-helix	586-599	14
α-helix	606-611	6

Chain M: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	256	1	78
α-helix	257-260	4
α-helix	264-273	10
β-strand	277	1	78
α-helix	278-282	5
α-helix	286-290	5
α-helix	297-309	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit alpha	G, H, M	protein	329	Escherichia coli (strain K12)	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	I	protein	1342	Escherichia coli (strain K12)	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	J	protein	1407	Escherichia coli (strain K12)	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	K	protein	91	Escherichia coli (strain K12)	P0A800 (AlphaFold model)
RNA polymerase sigma factor RpoD	L	protein	613	Escherichia coli K-12	P00579
Nontemplate strand of lamdba PR promoter DNA	O	DNA	105	Escherichia phage Lambda
Template strand of lamdba PR promoter DNA	P	DNA	105	Escherichia phage Lambda

Sequence of entity 1 (G, H, M), FASTA

>8TO8_1 DNA-directed RNA polymerase subunit alpha (chains G, H, M)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 2 (I), FASTA

>8TO8_2 DNA-directed RNA polymerase subunit beta (chains I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 3 (J), FASTA

>8TO8_3 DNA-directed RNA polymerase subunit beta' (chains J)
MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNE

Sequence of entity 4 (K), FASTA

>8TO8_4 DNA-directed RNA polymerase subunit omega (chains K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 5 (L), FASTA

>8TO8_5 RNA polymerase sigma factor RpoD (chains L)
MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAP
DADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIA
KRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATH
VGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGR
SHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKK
NFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKD
INRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFE
YRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTP
EELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESL
RAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRH
PSRSEVLRSFLDD

Sequence of entity 6 (O), FASTA

>8TO8_6 Nontemplate strand of lamdba PR promoter DNA (chains O)
CGGAATCGAGGGATCCTCTAGAGTTGGATAAATATCTAACACCGTGCGTGTTGACTATTT
TACCTCTGGCGGTGATAATGGTTGCATGTACTAAGGAGGTTGTCG

Sequence of entity 7 (P), FASTA

>8TO8_7 Template strand of lamdba PR promoter DNA (chains P)
CGACAACCTCCTTAGTACATGCAACCATTATCACCGCCAGAGGTAAAATAGTCAACACGC
ACGGTGTTAGATATTTATCCAACTCTAGAGGATCCCTCGATTCCG

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
4QM	(3R,5S,7R,8R,9S,10S,12S,13R,14S,17R)-10,13-dimethyl-17-[(2R)-pentan-2-yl]-2,3,4…	C24 H42 O3	4
ZN	Zinc ion	Zn	2

Primary citation

Early intermediates in bacterial RNA polymerase promoter melting visualized by time-resolved cryo-electron microscopy. Saecker, R.M., Mueller, A.U., Malone, B. et al. Nat Struct Mol Biol (2024) 31:1778-1788. DOI 10.1038/s41594-024-01349-9 · PubMed

Other PDB entries of the same protein (UniProt P0A7Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K4G 2.05 Å, Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
1BDF 2.5 Å, Structure of escherichia coli RNA polymerase alpha subunit N-terminal domain
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 8TO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.