8U1L: RAF1-HSP90-CDC37 complex in the closed state

Cryo-EM structure of the RAF1-HSP90-CDC37 complex in the closed state. Determined by electron microscopy at 3.7 Å resolution. Released 13 Mar 2024.

Method: Electron microscopy
Resolution: 3.7 Å
Organisms: Trichoplusia ni, Homo sapiens
Chains: 4
Atoms: 12,595
Mol. weight: 286.35 kDa
Ligands: MG, ATP
Released: 13 Mar 2024

Explore 8U1L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8U1L contains 74 α-helices and 70 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	1
β-strand	18-19	2	2
α-helix	21-31	11
α-helix	38-60	23
α-helix	62-67	6
β-strand	73-78	6	3
β-strand	83-88	6	3
α-helix	95-102	8
β-strand	104-105	2	4
α-helix	109-116	8
α-helix	118	1
α-helix	132-138	7
β-strand	140-148	9	3
β-strand	154-159	6	3
β-strand	164-169	6	3
β-strand	178-185	8	3
α-helix	187-193	7
α-helix	195-205	11
β-strand	213-217	5	3
β-strand	220	1	5
β-strand	273	1	5
β-strand	276-278	3	3
α-helix	287-289	3
α-helix	292-294	3
α-helix	297-308	12
β-strand	314-322	9	6
β-strand	328-335	8	6
β-strand	352-356	5	6
β-strand	359-362	4	6
α-helix	371-373	3
β-strand	377-382	6	6
β-strand	387	1	7
β-strand	394	1	7
α-helix	398-419	22
α-helix	422-442	21
α-helix	447-452	6
β-strand	455-456	2	8
β-strand	458	1	9
β-strand	466-467	2	8
α-helix	468-472	5
β-strand	481-486	6	9
α-helix	490-494	5
α-helix	499-504	6
β-strand	510-512	3	9
α-helix	517-523	7
β-strand	526-527	2	9
β-strand	530-534	5	9
β-strand	537	1	10
α-helix	546-570	25
α-helix	571-573	3
β-strand	576-579	4	11
β-strand	588-591	4	11
β-strand	592	1	10
α-helix	599-607	9
α-helix	613-616	4
α-helix	617-619	3
α-helix	620-623	4
β-strand	624-627	4	11
α-helix	632-643	12
α-helix	648-664	17
α-helix	667-669	3
α-helix	672-687	16

Chain B: 29 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	13-16	4	3
β-strand	18-19	2	4
α-helix	21-30	10
α-helix	36-38	3
α-helix	39-58	20
α-helix	62-67	6
β-strand	73-78	6	1
β-strand	83-88	6	1
α-helix	95-102	8
β-strand	104-105	2	2
α-helix	109-116	8
α-helix	118	1
α-helix	133-138	6
β-strand	140-148	9	1
β-strand	155-159	5	1
β-strand	164-169	6	1
β-strand	178-185	8	1
α-helix	187-193	7
α-helix	195-205	11
β-strand	213-218	6	1
α-helix	271-272	2
β-strand	275-278	4	1
α-helix	292-294	3
α-helix	297-308	12
α-helix	313	1
β-strand	314-324	11	12
β-strand	328-335	8	12
β-strand	351-356	6	12
β-strand	359-362	4	12
α-helix	371-373	3
β-strand	377-382	6	12
β-strand	387	1	13
β-strand	394	1	13
α-helix	398-418	21
α-helix	422-442	21
α-helix	447-451	5
β-strand	455-456	2	14
β-strand	458	1	15
β-strand	466-467	2	14
α-helix	468-473	6
β-strand	481-486	6	15
α-helix	490-494	5
α-helix	499-504	6
β-strand	510-512	3	15
α-helix	517-523	7
β-strand	526-527	2	15
β-strand	530-534	5	15
β-strand	537	1	16
α-helix	546-570	25
β-strand	576-579	4	17
β-strand	588-591	4	17
β-strand	592	1	16
α-helix	599-607	9
α-helix	620-623	4
β-strand	624-627	4	17
α-helix	632-643	12
α-helix	648-664	17
α-helix	667-669	3
α-helix	672-687	16

Chain C: 11 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	426-428	3	18
α-helix	429-431	3
α-helix	432-436	5
α-helix	442-461	20
β-strand	474-477	4	18
α-helix	478-480	3
β-strand	482-484	3	18
α-helix	514-517	4
α-helix	527-543	17
α-helix	554-563	10
α-helix	570-572	3
α-helix	579-588	10
α-helix	597-598	2
α-helix	599-611	13

Chain D: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	10	1	19
β-strand	23	1	18
α-helix	25-47	23
α-helix	103-111	9
α-helix	113	1
β-strand	114	1	19
α-helix	116-119	4
β-strand	120-123	4	12
β-strand	127-129	3	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein 83	A, B	protein	722	Trichoplusia ni	A0A7E5VSK5 (AlphaFold model)
RAF proto-oncogene serine/threonine-protein kinase	C	protein	656	Homo sapiens	P04049 (AlphaFold model)
Hsp90 co-chaperone Cdc37, N-terminally processed	D	protein	378	Homo sapiens	Q16543 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8U1L_1 Heat shock protein 83 (chains A, B)
MPEEMQTDSGEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLT
DPSKLDSGKELYIKIIPNKSEGTFTIIDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSCYLVADRVTVHSKHNDDEQYMWESSAGGSFTVRTDHGEPLGRGTK
IVLHIKEDLAEYLEVNKIKEIVKKHSQFIGYPIKLTVEKEREKELAYDEEEEKKEGEEDK
KEDEKEDEKPKIEDVGEDDEEDKDKKKKKTIKEKYTEDEELNKTKPIWTRNADDITQEEY
GDFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENKKRKNNIKLYVRRVF
IMDNCEDLIPEYLNFIKGVVDSEDLPLNISREMLQQNKILKVIRKNLVKKCLELFEELAE
DKENYKKYYEQFSKNLKLGIHEDAQNRTKLADLLRYHTSASGDEACSLKEYVSRMKENQK
HIYYITGENRDQVANSSFVERVKKRGYEVVYMTEPIDEYVVQQMREYDGKTLVSVTKEGL
ELPEDEEEKKKREEDKVKFEGLCKVMKNILDNKVEKVVVSNRLVESPCCIVTAQYGWSAN
MERIMKAQALRDTSTMGYMAAKKHLEINPDHSIVETLRQKAEADKNDKAVKDLVILLYET
ALLSSGFTLDEPQVHASRIYRMIKLGLGIDEDEPIQVEESSVGDVPPLEGDADDASRMEE
VD

Sequence of entity 2 (C), FASTA

>8U1L_2 RAF proto-oncogene serine/threonine-protein kinase (chains C)
GGEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR
VFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAA
SLIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTK
VPTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFT
FNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNN
LSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGS
FGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAI
VTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEG
LTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLY
ELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLF
PQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVFGHHHHHH

Sequence of entity 3 (D), FASTA

>8U1L_3 Hsp90 co-chaperone Cdc37, N-terminally processed (chains D)
MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK
VAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLS
KDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVH
LVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK
IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYES
LPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPG
DPLLEAVPKTGDEKDVSV

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2

Primary citation

Structural dynamics of RAF1-HSP90-CDC37 and HSP90 complexes reveal asymmetric client interactions and key structural elements. Finci, L.I., Chakrabarti, M., Gulten, G. et al. Commun Biol (2024) 7:260-260. DOI 10.1038/s42003-024-05959-3 · PubMed

Other PDB entries of the same protein (UniProt A0A7E5VSK5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8U1M 3.5 Å, Cryo-EM structure of the HSP90 dimer (NTD-MD) in the semi-open state
8U1N 3.9 Å, Cryo-EM structure of the cross-linked HSP90 dimer (NTD-MD) in the semi-open state

Browse structure collections

About this viewer

MolViewer shows 8U1L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.