8U1M: HSP90 dimer (NTD-MD) in the semi-open state

Cryo-EM structure of the HSP90 dimer (NTD-MD) in the semi-open state. Determined by electron microscopy at 3.5 Å resolution. Released 13 Mar 2024.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Trichoplusia ni
Chains: 2
Atoms: 7,882
Mol. weight: 167.71 kDa
Ligands: ATP, MG
Released: 13 Mar 2024

Explore 8U1M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8U1M contains 41 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	12-14	3	1
β-strand	19	1	2
α-helix	21-31	11
α-helix	38-60	23
α-helix	62-67	6
β-strand	73-78	6	3
β-strand	83-88	6	3
α-helix	95-97	3
α-helix	98-103	6
β-strand	104-105	2	4
α-helix	109-116	8
α-helix	132-138	7
β-strand	140-148	9	3
β-strand	154-159	6	3
β-strand	164-169	6	3
β-strand	178-185	8	3
α-helix	187-193	7
α-helix	195-205	11
β-strand	213-218	6	3
β-strand	275-278	4	3
α-helix	297-307	11
β-strand	314-322	9	5
β-strand	328-335	8	5
β-strand	352-356	5	5
β-strand	359-362	4	5
α-helix	371-373	3
β-strand	377-382	6	5
β-strand	387	1	6
β-strand	394	1	6
α-helix	397-418	22
α-helix	422-442	21
α-helix	447-451	5
β-strand	455-456	2	7
β-strand	458	1	8
α-helix	465	1
β-strand	466-467	2	7
α-helix	468-473	6
β-strand	484-485	2	8
β-strand	510-511	2	8
α-helix	512	1
α-helix	517-523	7

Chain B: 23 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	13-16	4	3
β-strand	18-19	2	4
α-helix	21-27	7
α-helix	28-32	5
α-helix	38-59	22
α-helix	62-64	3
β-strand	73-77	5	1
β-strand	83-88	6	1
α-helix	95-96	2
α-helix	97-101	5
β-strand	105	1	2
α-helix	109-116	8
α-helix	132-138	7
β-strand	140-148	9	1
α-helix	153	1
β-strand	154-159	6	1
β-strand	166-169	4	1
β-strand	178-185	8	1
α-helix	190-193	4
α-helix	195-205	11
β-strand	213	1	1
α-helix	284-286	3
α-helix	297-307	11
β-strand	316-322	7	9
β-strand	328-334	7	9
α-helix	340-342	3
β-strand	352	1	9
β-strand	355-356	2	9
β-strand	359-360	2	9
α-helix	365-368	4
α-helix	371-373	3
β-strand	377-382	6	9
α-helix	397-420	24
α-helix	422-442	21
α-helix	447-453	7
β-strand	455-456	2	10
β-strand	457	1	11
β-strand	466-467	2	10
α-helix	468-473	6
β-strand	482-483	2	12
β-strand	484-486	3	11
α-helix	490-494	5
α-helix	497-503	7
β-strand	510-512	3	11
α-helix	515-520	6
β-strand	526-527	2	13
β-strand	530-531	2	13
β-strand	532-533	2	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein 83	A, B	protein	722	Trichoplusia ni	A0A7E5VSK5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8U1M_1 Heat shock protein 83 (chains A, B)
MPEEMQTDSGEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLT
DPSKLDSGKELYIKIIPNKSEGTFTIIDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSCYLVADRVTVHSKHNDDEQYMWESSAGGSFTVRTDHGEPLGRGTK
IVLHIKEDLAEYLEVNKIKEIVKKHSQFIGYPIKLTVEKEREKELAYDEEEEKKEGEEDK
KEDEKEDEKPKIEDVGEDDEEDKDKKKKKTIKEKYTEDEELNKTKPIWTRNADDITQEEY
GDFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENKKRKNNIKLYVRRVF
IMDNCEDLIPEYLNFIKGVVDSEDLPLNISREMLQQNKILKVIRKNLVKKCLELFEELAE
DKENYKKYYEQFSKNLKLGIHEDAQNRTKLADLLRYHTSASGDEACSLKEYVSRMKENQK
HIYYITGENRDQVANSSFVERVKKRGYEVVYMTEPIDEYVVQQMREYDGKTLVSVTKEGL
ELPEDEEEKKKREEDKVKFEGLCKVMKNILDNKVEKVVVSNRLVESPCCIVTAQYGWSAN
MERIMKAQALRDTSTMGYMAAKKHLEINPDHSIVETLRQKAEADKNDKAVKDLVILLYET
ALLSSGFTLDEPQVHASRIYRMIKLGLGIDEDEPIQVEESSVGDVPPLEGDADDASRMEE
VD

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2
MG	Magnesium ion	Mg	2

Primary citation

Structural dynamics of RAF1-HSP90-CDC37 and HSP90 complexes reveal asymmetric client interactions and key structural elements. Finci, L.I., Chakrabarti, M., Gulten, G. et al. Commun Biol (2024) 7:260-260. DOI 10.1038/s42003-024-05959-3 · PubMed

Other PDB entries of the same protein (UniProt A0A7E5VSK5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8U1L 3.7 Å, Cryo-EM structure of the RAF1-HSP90-CDC37 complex in the closed state
8U1N 3.9 Å, Cryo-EM structure of the cross-linked HSP90 dimer (NTD-MD) in the semi-open state

Browse structure collections

About this viewer

MolViewer shows 8U1M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.