8U1N: Heat shock protein 83

Cryo-EM structure of the cross-linked HSP90 dimer (NTD-MD) in the semi-open state. Determined by electron microscopy at 3.9 Å resolution. Released 13 Mar 2024.

Method: Electron microscopy
Resolution: 3.9 Å
Organism: Trichoplusia ni
Chains: 2
Atoms: 8,164
Mol. weight: 167.71 kDa
Ligands: ATP, MG
Released: 13 Mar 2024

Explore 8U1N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8U1N contains 38 α-helices and 52 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	1
β-strand	18-19	2	2
α-helix	22-31	10
α-helix	39-60	22
α-helix	62-67	6
β-strand	73-75	3	3
β-strand	78	1	3
β-strand	83-88	6	3
α-helix	95-97	3
α-helix	98-102	5
β-strand	104-105	2	4
α-helix	109-116	8
α-helix	133-138	6
β-strand	140-148	9	3
β-strand	154-159	6	3
β-strand	164-169	6	3
β-strand	178-185	8	3
α-helix	187-193	7
α-helix	195-205	11
β-strand	213-215	3	3
α-helix	297-307	11
β-strand	314-322	9	5
β-strand	328-335	8	5
β-strand	352-354	3	5
β-strand	355	1	6
β-strand	360	1	6
α-helix	371-373	3
β-strand	377-382	6	5
β-strand	387	1	7
β-strand	394	1	7
α-helix	398-420	23
α-helix	422-442	21
α-helix	447-451	5
β-strand	455-456	2	8
β-strand	458	1	9
β-strand	466-467	2	8
α-helix	468-471	4
α-helix	472-474	3
β-strand	483-485	3	9
α-helix	492-495	4
α-helix	502-504	3
β-strand	509-511	3	9
α-helix	517-523	7
β-strand	527	1	10
β-strand	530	1	10
β-strand	533-534	2	9

Chain B: 19 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	13-16	4	3
β-strand	18-19	2	4
α-helix	21-31	11
α-helix	39-60	22
β-strand	73-77	5	1
β-strand	83-88	6	1
α-helix	95-96	2
α-helix	97-101	5
β-strand	104-105	2	2
α-helix	109-114	6
α-helix	133-138	6
β-strand	140-148	9	1
β-strand	154-159	6	1
β-strand	164-169	6	1
β-strand	178-185	8	1
α-helix	190-193	4
α-helix	195-205	11
β-strand	213	1	1
α-helix	269-271	3
α-helix	297-308	12
β-strand	317-322	6	11
β-strand	328-333	6	11
β-strand	352-356	5	11
β-strand	360-362	3	11
α-helix	371-373	3
β-strand	377-382	6	11
α-helix	397-417	21
α-helix	418-420	3
α-helix	422-442	21
α-helix	447-453	7
β-strand	455-456	2	12
β-strand	457	1	13
β-strand	466-467	2	12
α-helix	468-473	6
β-strand	482-483	2	14
β-strand	484	1	15
α-helix	490-494	5
α-helix	497-503	7
β-strand	510	1	15
β-strand	511	1	13
α-helix	515-520	6
β-strand	526-527	2	16
β-strand	530-531	2	16
β-strand	532-533	2	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein 83	A, B	protein	722	Trichoplusia ni	A0A7E5VSK5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8U1N_1 Heat shock protein 83 (chains A, B)
MPEEMQTDSGEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLT
DPSKLDSGKELYIKIIPNKSEGTFTIIDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSCYLVADRVTVHSKHNDDEQYMWESSAGGSFTVRTDHGEPLGRGTK
IVLHIKEDLAEYLEVNKIKEIVKKHSQFIGYPIKLTVEKEREKELAYDEEEEKKEGEEDK
KEDEKEDEKPKIEDVGEDDEEDKDKKKKKTIKEKYTEDEELNKTKPIWTRNADDITQEEY
GDFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENKKRKNNIKLYVRRVF
IMDNCEDLIPEYLNFIKGVVDSEDLPLNISREMLQQNKILKVIRKNLVKKCLELFEELAE
DKENYKKYYEQFSKNLKLGIHEDAQNRTKLADLLRYHTSASGDEACSLKEYVSRMKENQK
HIYYITGENRDQVANSSFVERVKKRGYEVVYMTEPIDEYVVQQMREYDGKTLVSVTKEGL
ELPEDEEEKKKREEDKVKFEGLCKVMKNILDNKVEKVVVSNRLVESPCCIVTAQYGWSAN
MERIMKAQALRDTSTMGYMAAKKHLEINPDHSIVETLRQKAEADKNDKAVKDLVILLYET
ALLSSGFTLDEPQVHASRIYRMIKLGLGIDEDEPIQVEESSVGDVPPLEGDADDASRMEE
VD

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2
MG	Magnesium ion	Mg	2

Primary citation

Structural dynamics of RAF1-HSP90-CDC37 and HSP90 complexes reveal asymmetric client interactions and key structural elements. Finci, L.I., Chakrabarti, M., Gulten, G. et al. Commun Biol (2024) 7:260-260. DOI 10.1038/s42003-024-05959-3 · PubMed

Other PDB entries of the same protein (UniProt A0A7E5VSK5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8U1M 3.5 Å, Cryo-EM structure of the HSP90 dimer (NTD-MD) in the semi-open state
8U1L 3.7 Å, Cryo-EM structure of the RAF1-HSP90-CDC37 complex in the closed state

Browse structure collections

About this viewer

MolViewer shows 8U1N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.