8U80: BTB/POZ domain-containing protein KCTD5
KCTD5/Cullin3/Gbeta1gamma2 Complex: Local Refinment of KCTD5(BTB)/Cullin3(NTD). Determined by electron microscopy at 3.6 Å resolution. Released 11 Oct 2023.
- Method
- Electron microscopy
- Resolution
- 3.6 Å
- Organism
- Homo sapiens
- Chains
- 10
- Atoms
- 19,260
- Mol. weight
- 353.3 kDa
- Released
- 11 Oct 2023
Explore 8U80 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8U80 contains 167 α-helices and 22 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain C1: 28 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 29-44 | 16 | |
| α-helix | 49-51 | 3 | |
| α-helix | 54-66 | 13 | |
| α-helix | 70-84 | 15 | |
| α-helix | 85-89 | 5 | |
| α-helix | 90-95 | 6 | |
| α-helix | 96-98 | 3 | |
| α-helix | 101-122 | 22 | |
| α-helix | 124-128 | 5 | |
| α-helix | 130-134 | 5 | |
| α-helix | 139-147 | 9 | |
| α-helix | 148-152 | 5 | |
| α-helix | 155-174 | 20 | |
| α-helix | 180-193 | 14 | |
| α-helix | 199-201 | 3 | |
| α-helix | 202-206 | 5 | |
| α-helix | 207-225 | 19 | |
| α-helix | 230-251 | 22 | |
| α-helix | 254-256 | 3 | |
| α-helix | 257-265 | 9 | |
| α-helix | 266-270 | 5 | |
| α-helix | 273-277 | 5 | |
| α-helix | 284-290 | 7 | |
| α-helix | 293-303 | 11 | |
| α-helix | 309-329 | 21 | |
| α-helix | 338-342 | 5 | |
| α-helix | 344-358 | 15 | |
| α-helix | 364-378 | 15 | |
Chain C2: 27 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 29-46 | 18 | |
| α-helix | 54-66 | 13 | |
| α-helix | 70-84 | 15 | |
| α-helix | 85-89 | 5 | |
| α-helix | 90-95 | 6 | |
| α-helix | 101-122 | 22 | |
| α-helix | 124-134 | 11 | |
| α-helix | 136-138 | 3 | |
| α-helix | 139-147 | 9 | |
| α-helix | 148-152 | 5 | |
| α-helix | 155-173 | 19 | |
| α-helix | 180-193 | 14 | |
| α-helix | 199-201 | 3 | |
| α-helix | 202-206 | 5 | |
| α-helix | 207-225 | 19 | |
| α-helix | 230-250 | 21 | |
| α-helix | 254-256 | 3 | |
| α-helix | 257-264 | 8 | |
| α-helix | 265-269 | 5 | |
| α-helix | 270-272 | 3 | |
| α-helix | 273-277 | 5 | |
| α-helix | 284-290 | 7 | |
| α-helix | 293-303 | 11 | |
| α-helix | 309-329 | 21 | |
| α-helix | 338-342 | 5 | |
| α-helix | 344-358 | 15 | |
| α-helix | 364-378 | 15 | |
Chain C3: 25 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-45 | 19 | |
| α-helix | 54-66 | 13 | |
| α-helix | 70-84 | 15 | |
| α-helix | 85-89 | 5 | |
| α-helix | 90-94 | 5 | |
| α-helix | 101-122 | 22 | |
| α-helix | 130-134 | 5 | |
| α-helix | 139-147 | 9 | |
| α-helix | 148-152 | 5 | |
| α-helix | 155-174 | 20 | |
| α-helix | 180-193 | 14 | |
| α-helix | 199-201 | 3 | |
| α-helix | 202-206 | 5 | |
| α-helix | 207-227 | 21 | |
| α-helix | 230-251 | 22 | |
| α-helix | 254-256 | 3 | |
| α-helix | 257-265 | 9 | |
| α-helix | 266-270 | 5 | |
| α-helix | 273-276 | 4 | |
| β-strand | 279 | 1 | 7 |
| β-strand | 282 | 1 | 7 |
| α-helix | 284-290 | 7 | |
| α-helix | 293-303 | 11 | |
| α-helix | 309-329 | 21 | |
| α-helix | 338-342 | 5 | |
| α-helix | 344-358 | 15 | |
| α-helix | 364-378 | 15 | |
Chain C4: 29 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 29-45 | 17 | |
| α-helix | 49-51 | 3 | |
| α-helix | 54-66 | 13 | |
| α-helix | 70-84 | 15 | |
| α-helix | 85-89 | 5 | |
| α-helix | 90-95 | 6 | |
| α-helix | 101-122 | 22 | |
| α-helix | 124-129 | 6 | |
| α-helix | 131-134 | 4 | |
| α-helix | 136-138 | 3 | |
| α-helix | 139-147 | 9 | |
| α-helix | 148-152 | 5 | |
| α-helix | 155-173 | 19 | |
| α-helix | 180-193 | 14 | |
| α-helix | 199-201 | 3 | |
| α-helix | 202-206 | 5 | |
| α-helix | 207-225 | 19 | |
| α-helix | 230-250 | 21 | |
| α-helix | 254-256 | 3 | |
| α-helix | 257-265 | 9 | |
| α-helix | 266-270 | 5 | |
| α-helix | 273-277 | 5 | |
| α-helix | 284-290 | 7 | |
| α-helix | 293-303 | 11 | |
| α-helix | 309-329 | 21 | |
| α-helix | 338-342 | 5 | |
| α-helix | 344-358 | 15 | |
| α-helix | 364-369 | 6 | |
| α-helix | 371-378 | 8 | |
Chain C5: 27 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 29-45 | 17 | |
| α-helix | 49-51 | 3 | |
| α-helix | 54-66 | 13 | |
| α-helix | 70-84 | 15 | |
| α-helix | 85-90 | 6 | |
| α-helix | 91-95 | 5 | |
| α-helix | 101-122 | 22 | |
| α-helix | 126-129 | 4 | |
| α-helix | 131-134 | 4 | |
| α-helix | 139-147 | 9 | |
| α-helix | 148-152 | 5 | |
| α-helix | 155-174 | 20 | |
| α-helix | 180-193 | 14 | |
| α-helix | 199-201 | 3 | |
| α-helix | 202-206 | 5 | |
| α-helix | 207-225 | 19 | |
| α-helix | 230-250 | 21 | |
| α-helix | 254-256 | 3 | |
| α-helix | 257-264 | 8 | |
| α-helix | 265-270 | 6 | |
| α-helix | 273-277 | 5 | |
| α-helix | 284-290 | 7 | |
| α-helix | 293-303 | 11 | |
| α-helix | 309-329 | 21 | |
| α-helix | 338-342 | 5 | |
| α-helix | 344-358 | 15 | |
| α-helix | 364-378 | 15 | |
Chain K1: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 45-50 | 6 | 1 |
| β-strand | 53-58 | 6 | 1 |
| α-helix | 59-62 | 4 | |
| α-helix | 69-74 | 6 | |
| β-strand | 83-84 | 2 | 2 |
| β-strand | 89-90 | 2 | 2 |
| β-strand | 91-92 | 2 | 1 |
| α-helix | 99-108 | 10 | |
| α-helix | 119-129 | 11 | |
| α-helix | 132-149 | 18 | |
Chain K2: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 45-48 | 4 | 3 |
| α-helix | 50-52 | 3 | |
| β-strand | 55-58 | 4 | 3 |
| α-helix | 59-62 | 4 | |
| α-helix | 69-74 | 6 | |
| β-strand | 90 | 1 | 3 |
| α-helix | 99-108 | 10 | |
| α-helix | 119-129 | 11 | |
| α-helix | 132-149 | 18 | |
Chain K3: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 45-50 | 6 | 4 |
| β-strand | 53-58 | 6 | 4 |
| α-helix | 59-62 | 4 | |
| α-helix | 69-74 | 6 | |
| β-strand | 83 | 1 | 4 |
| β-strand | 90-92 | 3 | 4 |
| α-helix | 96-108 | 13 | |
| α-helix | 119-129 | 11 | |
| α-helix | 132-150 | 19 | |
2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| BTB/POZ domain-containing protein KCTD5 | K1, K2, K3, K4, K5 | protein | 234 | Homo sapiens | Q9NXV2 (AlphaFold model) |
| Cullin-3 | C1, C2, C3, C4, C5 | protein | 381 | Homo sapiens | Q13618 (AlphaFold model) |
Sequence of entity 1 (K1, K2, K3, K4, K5), FASTA
>8U80_1 BTB/POZ domain-containing protein KCTD5 (chains K1, K2, K3, K4, K5)
MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQ
TLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEE
GVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWK
FEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM
Sequence of entity 2 (C1, C2, C3, C4, C5), FASTA
>8U80_2 Cullin-3 (chains C1, C2, C3, C4, C5)
MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRN
AYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIR
DILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDR
GAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEAR
INEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMY
KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESF
NNDRLFKQTIAGDFEYFLNLN
Primary citation
Structure and dynamics of a pentameric KCTD5/CUL3/G beta gamma E3 ubiquitin ligase complex. Nguyen, D.M., Rath, D.H., Devost, D. et al. Proc Natl Acad Sci U S A (2024) 121:e2315018121-e2315018121. DOI 10.1073/pnas.2315018121 · PubMed
Other PDB entries of the same protein (UniProt Q9NXV2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3DRZ 1.9 Å, X-ray crystal structure of the N-terminal BTB domain of human KCTD5 protein
- 8U7Z 2.97 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: Local Refinment of KCTD5(CTD)/Gbeta1gamma2
- 3DRX 3.11 Å, X-ray crystal structure of human KCTD5 protein crystallized in high-salt buffer
- 3DRY 3.3 Å, X-ray crystal structure of human KCTD5 protein crystallized in low-salt buffer
- 8U81 3.82 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: State A From Composite RELION Multi-body Refinement…
- 8U82 3.84 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: State B From Composite RELION Multi-body Refinement…
- 8U84 3.88 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: State D From Composite RELION Multi-body Refinement…
- 8U83 3.98 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: State C From Composite RELION Multi-body Refinement…
Browse structure collections
About this viewer
MolViewer shows 8U80 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.