8U9L: RelA-cRel chimera complex with DNA

Crystal Structure of RelA-cRel chimera complex with DNA. Determined by X-ray diffraction at 3.09 Å resolution. Released 2 Oct 2024.

Method: X-ray diffraction
Resolution: 3.09 Å
Organisms: Homo sapiens, Mus musculus
Chains: 16
Atoms: 20,864
Mol. weight: 300.83 kDa
Released: 2 Oct 2024

Explore 8U9L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8U9L contains 112 α-helices and 215 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and G: 14 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	1
α-helix	9	1
β-strand	10	1	2
α-helix	11	1
β-strand	18-19	2	3
α-helix	29-30	2
β-strand	31	1	2
β-strand	43-47	5	1
β-strand	54-60	7	4
α-helix	67	1
β-strand	68	1	4
α-helix	69	1
β-strand	72-73	2	3
β-strand	78-79	2	4
β-strand	82-84	3	4
β-strand	94-95	2	1
β-strand	101-103	3	3
α-helix	104-105	2
α-helix	109-118	10
α-helix	128-131	4
α-helix	137-139	3
β-strand	141-142	2	5
β-strand	143-149	7	4
α-helix	161-163	3
β-strand	164-165	2	4
β-strand	169-170	2	5
α-helix	179-180	2
β-strand	182-185	4	6
β-strand	189-191	3	7
β-strand	197-202	6	6
β-strand	211-216	6	7
β-strand	219-222	4	7
α-helix	227-229	3
β-strand	230-231	2	6
β-strand	235-239	5	6
α-helix	240-243	4
β-strand	252-260	9	7
β-strand	265-266	2	7
α-helix	267-269	3
β-strand	270-275	6	7

Chain B: 13 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	8
α-helix	9	1
β-strand	10	1	9
α-helix	11	1
β-strand	18-19	2	10
α-helix	29-30	2
β-strand	31	1	9
β-strand	43-47	5	8
β-strand	53-60	8	11
α-helix	67	1
β-strand	68	1	11
α-helix	69	1
β-strand	72-75	4	10
β-strand	78-79	2	11
β-strand	82-87	6	11
β-strand	94-95	2	8
β-strand	99-103	5	10
α-helix	106-108	3
α-helix	109-118	10
α-helix	128-131	4
β-strand	141-150	10	11
β-strand	159-160	2	11
α-helix	161-163	3
β-strand	164-170	7	11
α-helix	179-180	2
β-strand	182-185	4	12
β-strand	189-191	3	13
β-strand	197-202	6	12
β-strand	211-216	6	13
β-strand	219-221	3	13
α-helix	227-229	3
β-strand	230-231	2	12
β-strand	235-239	5	12
α-helix	240-243	4
β-strand	252-260	9	13
β-strand	265-266	2	13
α-helix	267-269	3
β-strand	270-275	6	13

Chain H: 14 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	21
α-helix	9	1
β-strand	10	1	22
α-helix	11	1
β-strand	18	1	23
α-helix	29-30	2
β-strand	31	1	22
β-strand	43-47	5	21
β-strand	53-60	8	24
α-helix	67	1
β-strand	68	1	24
α-helix	69	1
β-strand	72-75	4	23
β-strand	78-79	2	24
β-strand	82-87	6	24
β-strand	94-95	2	21
β-strand	99-102	4	23
α-helix	106-108	3
α-helix	110-118	9
α-helix	128-131	4
β-strand	141-142	2	25
β-strand	143-150	8	24
β-strand	159-160	2	24
α-helix	161-163	3
β-strand	164-165	2	24
β-strand	169-170	2	25
α-helix	179-180	2
β-strand	182-185	4	26
β-strand	189-191	3	27
β-strand	197-202	6	26
α-helix	207-209	3
β-strand	211-216	6	27
β-strand	219-222	4	27
α-helix	227-229	3
β-strand	230-231	2	26
β-strand	235-239	5	26
α-helix	240-243	4
β-strand	252-260	9	27
β-strand	265-266	2	27
α-helix	267-269	3
β-strand	270-275	6	27

Chain K: 15 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	28
α-helix	9	1
β-strand	10	1	29
α-helix	11	1
β-strand	18-19	2	30
α-helix	29-30	2
β-strand	31	1	29
β-strand	43-47	5	28
β-strand	54-60	7	31
α-helix	67	1
β-strand	68	1	31
α-helix	69	1
β-strand	72-73	2	30
β-strand	78-79	2	31
β-strand	82-84	3	31
β-strand	94-95	2	28
β-strand	101-103	3	30
α-helix	104-105	2
α-helix	109-118	10
α-helix	128-131	4
α-helix	137-139	3
β-strand	141-142	2	32
β-strand	143-149	7	31
α-helix	161-163	3
β-strand	164-165	2	31
β-strand	169-170	2	32
α-helix	179-180	2
β-strand	182-185	4	33
β-strand	189-191	3	34
β-strand	197-202	6	33
α-helix	207-209	3
β-strand	211-216	6	34
β-strand	219-222	4	34
α-helix	227-229	3
β-strand	230-231	2	33
β-strand	235-239	5	33
α-helix	240-243	4
β-strand	252-260	9	34
β-strand	265-266	2	34
α-helix	267-269	3
β-strand	270-275	6	34

Chain L: 14 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	35
α-helix	9	1
β-strand	10	1	36
α-helix	11	1
β-strand	18-19	2	37
α-helix	29-30	2
β-strand	31	1	36
β-strand	43-47	5	35
β-strand	53-60	8	38
α-helix	67	1
β-strand	68	1	38
α-helix	69	1
β-strand	72-75	4	37
β-strand	78-79	2	38
β-strand	82-87	6	38
β-strand	94-95	2	35
β-strand	99-103	5	37
α-helix	104-105	2
α-helix	106-108	3
α-helix	109-118	10
α-helix	128-131	4
β-strand	141-142	2	39
β-strand	143-150	8	38
β-strand	159-160	2	38
α-helix	161-163	3
β-strand	164-165	2	38
β-strand	169-170	2	39
α-helix	179-180	2
β-strand	182-185	4	40
β-strand	189-191	3	41
β-strand	197-202	6	40
β-strand	211-216	6	41
β-strand	219-222	4	41
α-helix	227-229	3
β-strand	230	1	40
β-strand	235-239	5	40
α-helix	240-243	4
β-strand	252-260	9	41
β-strand	265-266	2	41
α-helix	267-269	3
β-strand	270-275	6	41

Chain O: 14 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	42
α-helix	9	1
β-strand	10	1	43
α-helix	11	1
β-strand	18-19	2	44
α-helix	20-22	3
α-helix	29-30	2
β-strand	31	1	43
β-strand	43-47	5	42
β-strand	54-60	7	45
β-strand	68	1	45
β-strand	72-73	2	44
β-strand	78-79	2	45
β-strand	82-84	3	45
β-strand	94-95	2	42
β-strand	101-103	3	44
α-helix	104-105	2
α-helix	109-118	10
α-helix	128-131	4
α-helix	137-139	3
β-strand	141-142	2	46
β-strand	143-149	7	45
α-helix	161-163	3
β-strand	164-165	2	45
β-strand	169-170	2	46
α-helix	179-180	2
β-strand	182-185	4	47
β-strand	189-191	3	48
β-strand	197-202	6	47
β-strand	211-216	6	48
β-strand	219-222	4	48
β-strand	224	1	47
α-helix	227-229	3
β-strand	230	1	47
α-helix	231-233	3
β-strand	235-239	5	47
α-helix	240-243	4
β-strand	252-260	9	48
β-strand	265-266	2	48
α-helix	267-269	3
β-strand	270-275	6	48

Chain P: 14 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	49
α-helix	9	1
β-strand	10	1	50
α-helix	11	1
β-strand	13	1	51
β-strand	18-19	2	52
α-helix	20-22	3
α-helix	29-30	2
β-strand	31	1	50
β-strand	43-47	5	49
β-strand	48	1	11
β-strand	53-60	8	53
α-helix	67	1
β-strand	68	1	53
α-helix	69	1
β-strand	72-73	2	52
β-strand	78-79	2	53
β-strand	82-87	6	53
β-strand	94-95	2	49
β-strand	101-103	3	52
α-helix	106-108	3
α-helix	109-118	10
α-helix	128-131	4
β-strand	141-142	2	51
β-strand	143-150	8	53
β-strand	159-160	2	53
α-helix	161-163	3
β-strand	164-165	2	53
β-strand	169-170	2	51
α-helix	179-180	2
β-strand	182-185	4	54
β-strand	189-191	3	55
β-strand	197-202	6	54
β-strand	206	1	56
β-strand	209	1	56
β-strand	211-216	6	55
β-strand	219-222	4	55
α-helix	227-229	3
β-strand	230-231	2	54
β-strand	235-239	5	54
α-helix	240-243	4
β-strand	252-260	9	55
β-strand	265-266	2	55
α-helix	267-269	3
β-strand	270-275	6	55

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(ptptpgpaptpgpgpgpapaptptptpcpcpgpaptptpc)-3')	C, E, I, M	DNA	20	Homo sapiens
DNA (5'-d(pgpapaptpcpgpgpapapaptptpcpcpcpaptpcpapa)-3')	D, F, J, N	DNA	20	Homo sapiens
Transcription factor p65,Proto-oncogene c-Rel chimera	A, B, G, H, K, L, O, P	protein	277	Mus musculus	P15307 (AlphaFold model), Q04207 (AlphaFold model)

Sequence of entity 1 (C, E, I, M), FASTA

>8U9L_1 DNA (5'-D(P*TP*TP*GP*AP*TP*GP*GP*GP*AP*AP*TP*TP*TP*CP*CP*GP*AP*TP*TP*C)-3') (chains C, E, I, M)
TTGATGGGAATTTCCGATTC

Sequence of entity 2 (D, F, J, N), FASTA

>8U9L_2 DNA (5'-D(P*GP*AP*AP*TP*CP*GP*GP*AP*AP*AP*TP*TP*CP*CP*CP*AP*TP*CP*AP*A)-3') (chains D, F, J, N)
GAATCGGAAATTCCCATCAA

Sequence of entity 3 (A, B, G, H, K, L, O, P), FASTA

>8U9L_3 Transcription factor p65,Proto-oncogene c-Rel chimera (chains A, B, G, H, K, L, O, P)
MPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLV
TKDPPHRPHPHELVGKDCRDGYYEAEFGPERRPLFFQNLGIRCVKKKEVKEAIILRISAG
INPFNVPEQQLLDIEDCDLNVVRLCFQVFLPDEHGNFTTALPPIVSNPIYDNRAPNTAEL
KICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRT
PPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD

Primary citation

Stepwise neofunctionalization of the NF-kappa B family member Rel during vertebrate evolution. Daly, A.E., Chang, A.B., Purbey, P.K. et al. Nat Immunol (2025) 26:760-774. DOI 10.1038/s41590-025-02138-2 · PubMed

Browse structure collections

About this viewer

MolViewer shows 8U9L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.