8UAC: Cathepsin L

Cathepsin L in complex with AC1115. Determined by X-ray diffraction at 1.4 Å resolution. Released 7 Feb 2024.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,701
Mol. weight: 49.21 kDa
Ligands: W28
Released: 7 Feb 2024

Explore 8UAC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8UAC contains 22 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	1
α-helix	7-10	4
α-helix	14-16	3
β-strand	18	1	2
α-helix	25-42	18
β-strand	48	1	3
α-helix	50-56	7
α-helix	58-60	3
α-helix	64-66	3
α-helix	70-80	11
β-strand	83-84	2	4
β-strand	85	1	3
α-helix	102-104	3
β-strand	105-107	3	4
β-strand	111-114	4	1
α-helix	115-116	2
α-helix	119-128	10
β-strand	132-136	5	1
α-helix	141-144	4
β-strand	150-151	2	1
β-strand	163-172	10	1
β-strand	181-186	6	1
β-strand	189	1	2
β-strand	195	1	1
β-strand	198-202	5	1
α-helix	208-210	3
β-strand	216-219	4	1

Chain B: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	5
α-helix	7-10	4
α-helix	14-16	3
β-strand	18	1	6
β-strand	23	1	7
α-helix	25-42	18
β-strand	48	1	8
α-helix	50-56	7
α-helix	58-60	3
β-strand	66	1	7
α-helix	70-80	11
β-strand	83-84	2	9
β-strand	85	1	8
α-helix	102-104	3
β-strand	105-107	3	9
β-strand	111-114	4	5
α-helix	119-128	10
β-strand	132-136	5	5
α-helix	141-144	4
β-strand	150-151	2	5
β-strand	163-172	10	5
β-strand	181-186	6	5
β-strand	189	1	6
β-strand	195	1	5
β-strand	198-202	5	5
α-helix	208-210	3
β-strand	216-219	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cathepsin L	A, B	protein	220	Homo sapiens	P07711 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8UAC_1 Cathepsin L (chains A, B)
APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQ
GNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEK
ALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNN
KYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV

Ligands and cofactors

ID	Name	Formula	Copies
W28	N-[(2S)-1-({(2S)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propan-2-yl}amino)-4-me…	C22 H30 N4 O4	2

Primary citation

Olgotrelvir, a dual inhibitor of SARS-CoV-2 M pro and cathepsin L, as a standalone antiviral oral intervention candidate for COVID-19. Mao, L., Shaabani, N., Zhang, X. et al. Med (2024) 5:42-61.e23. DOI 10.1016/j.medj.2023.12.004 · PubMed

Other PDB entries of the same protein (UniProt P07711 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XU3 0.9 Å, Cathepsin L with a nitrile inhibitor
5MAE 1.0 Å, CATHEPSIN L IN COMPLEX WITH (2S,4R)-4-(2-Chloro-4-methoxy-benzenesulfonyl)-1-[3-(5-chloro…
5MAJ 1.0 Å, CATHEPSIN L IN COMPLEX WITH 4-[cyclopentyl(imidazo[1,2-a]pyridin-2-ylmethyl)amino]-6-morp…
2XU4 1.12 Å, Cathepsin L with a nitrile inhibitor
5MQY 1.13 Å, CATHEPSIN L IN COMPLEX WITH 4-[1,3-benzodioxol-5-ylmethyl(2-phenoxyethyl)amino]-5-fluorop…
2YJC 1.14 Å, Cathepsin L with a nitrile inhibitor
2YJ2 1.15 Å, Cathepsin L with a nitrile inhibitor
3HHA 1.27 Å, Crystal structure of cathepsin L in complex with AZ12878478
2YJ8 1.3 Å, Cathepsin L with a nitrile inhibitor
2YJ9 1.35 Å, Cathepsin L with a nitrile inhibitor
7Z58 1.35 Å, Crystal structure of human Cathepsin L in complex with covalently bound Calpeptin
6EZP 1.37 Å, CATHEPSIN L IN COMPLEX WITH (3S,14E)-19-chloro-N-(1-cyanocyclopropyl)-5-oxo-12,17-dioxa-4…

Browse structure collections

About this viewer

MolViewer shows 8UAC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.