8UBI: NRCAM nucleosome aided by scFv
Cryo-EM structure of NRCAM nucleosome aided by scFv (Class_A). Determined by electron microscopy at 2.8 Å resolution. Released 21 Jan 2026.
- Method
- Electron microscopy
- Resolution
- 2.8 Å
- Organisms
- Homo sapiens, Mus musculus
- Chains
- 12
- Atoms
- 16,288
- Mol. weight
- 245.45 kDa
- Released
- 21 Jan 2026
Explore 8UBI in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8UBI contains 51 α-helices and 67 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 41-42 | 2 | |
| α-helix | 45-56 | 12 | |
| α-helix | 64-76 | 13 | |
| β-strand | 83-84 | 2 | 1 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 2 |
| α-helix | 121-131 | 11 | |
Chain B: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-28 | 3 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 2 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 1 |
| α-helix | 83-92 | 10 | |
| β-strand | 97-98 | 2 | 3 |
Chain C: 7 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-14 | 4 | |
| α-helix | 17-21 | 5 | |
| α-helix | 27-36 | 10 | |
| β-strand | 42-43 | 2 | 4 |
| α-helix | 46-72 | 27 | |
| β-strand | 77-78 | 2 | 5 |
| α-helix | 80-88 | 9 | |
| α-helix | 91-96 | 6 | |
| β-strand | 100-102 | 3 | 6 |
| α-helix | 113-115 | 3 | |
Chain D: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 31-33 | 3 | |
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 5 |
| α-helix | 56-83 | 28 | |
| β-strand | 88-89 | 2 | 4 |
| α-helix | 91-101 | 11 | |
| α-helix | 104-123 | 20 | |
Chain E: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 41-42 | 2 | |
| α-helix | 45-56 | 12 | |
| α-helix | 64-75 | 12 | |
| β-strand | 83-84 | 2 | 7 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 8 |
| α-helix | 121-131 | 11 | |
Chain F: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-28 | 3 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 8 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 7 |
| α-helix | 83-92 | 10 | |
| β-strand | 96-98 | 3 | 6 |
Chain G: 7 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-14 | 3 | |
| α-helix | 17-21 | 5 | |
| α-helix | 27-36 | 10 | |
| β-strand | 42-43 | 2 | 9 |
| α-helix | 46-72 | 27 | |
| β-strand | 77-78 | 2 | 10 |
| α-helix | 80-88 | 9 | |
| α-helix | 91-96 | 6 | |
| β-strand | 101-102 | 2 | 3 |
| α-helix | 113-115 | 3 | |
Chain H: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 10 |
| α-helix | 56-83 | 28 | |
| β-strand | 88-89 | 2 | 9 |
| α-helix | 91-101 | 11 | |
| α-helix | 105-123 | 19 | |
2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone H3 | A, E | protein | 97 | Homo sapiens | H2PI50 (AlphaFold model) |
| Histone H4 | B, F | protein | 83 | Homo sapiens | A0A9J8D176 (AlphaFold model) |
| Histone H2A | C, G | protein | 109 | Homo sapiens | L8IQP7 (AlphaFold model) |
| Histone H2B type 1-J | D, H | protein | 95 | Homo sapiens | P06899 (AlphaFold model) |
| Nrcam DNA (162-mer) | I | DNA | 162 | Mus musculus | |
| Nrcam DNA (162-mer) | J | DNA | 162 | Mus musculus | |
| scFv | M, N | protein | 270 | Mus musculus | |
Sequence of entity 1 (A, E), FASTA
>8UBI_1 Histone H3 (chains A, E)
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAC
EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Sequence of entity 2 (B, F), FASTA
>8UBI_2 Histone H4 (chains B, F)
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
Sequence of entity 3 (C, G), FASTA
>8UBI_3 Histone H2A (chains C, G)
ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNA
ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Sequence of entity 4 (D, H), FASTA
>8UBI_4 Histone H2B type 1-J (chains D, H)
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTI
TSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Sequence of entity 5 (I), FASTA
>8UBI_5 NRCAM DNA (162-MER) (chains I)
GATCCATTACTTCTGAAACAGATGACTCCCAGCAGCTGCTGCCTGTGGCCCACAGGGCTT
CCTGCCCTGCATGACAGCTGCACATCACATCCTGTGGTCATACTACTTCAGCCGCTTCTA
CGGCCAGATACAAAAGTGGGTGGGGAACATAGGCAAGGGATC
Sequence of entity 6 (J), FASTA
>8UBI_6 NRCAM DNA (162-MER) (chains J)
GATCCCTTGCCTATGTTCCCCACCCACTTTTGTATCTGGCCGTAGAAGCGGCTGAAGTAG
TATGACCACAGGATGTGATGTGCAGCTGTCATGCAGGGCAGGAAGCCCTGTGGGCCACAG
GCAGCAGCTGCTGGGAGTCATCTGTTTCAGAAGTAATGGATC
Sequence of entity 7 (M, N), FASTA
>8UBI_7 scFv (chains M, N)
MKSSHHHHHHENLYFQSNAMDIKMTQSPSSMHASLGERVTITCKASQDIRSYLSWYQQKP
WKSPKTLIYYATSLADGVPSRFSGSGSGQDFSLTINNLESDDTATYYCLQHGESPYTFGS
GTKLEIKRAGGGGSGGGGSGGGGSGGGGSMEVQLQQSGPELVEPGTSVKMPCKASGYTFT
SYTIQWVKQTPRQGLEWIGYIYPYNAGTKYNEKFKGKATLTSDKSSSTVYMELSSLTSED
SAVYYCARKSSRLRSTLDYWGQGTSVTVSS
Primary citation
Distinct associations of pioneer factor Ascl1-E12a with nucleosomes drive changes in cell fate. Zhou, B.R., Luzete-Monteiro, E., Zhang, J. et al. Mol Cell (2026). DOI 10.1016/j.molcel.2026.05.020 · PubMed
Browse structure collections
About this viewer
MolViewer shows 8UBI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.