8UMO: Murine CD94-NKG2A receptor

Murine CD94-NKG2A receptor in complex with Qa-1b presenting AMAPRTLLL. Determined by X-ray diffraction at 2.6 Å resolution. Released 17 Jan 2024.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Mus musculus
Chains: 5
Atoms: 5,140
Mol. weight: 72.86 kDa
Released: 17 Jan 2024

Explore 8UMO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8UMO contains 14 α-helices and 53 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	1
α-helix	20	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-54	5
α-helix	57-85	29
β-strand	94-103	10	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-149	12
α-helix	152-161	10
α-helix	163-174	12
α-helix	176-179	4
β-strand	183	1	2
β-strand	186-193	8	3
β-strand	198-208	11	3
β-strand	209	1	2
β-strand	214-219	6	4
β-strand	223	1	4
α-helix	227-228	2
β-strand	229-230	2	3
α-helix	231-233	3
β-strand	234-235	2	3
β-strand	241-250	10	3
α-helix	254-256	3
β-strand	257-262	6	4
β-strand	270-272	3	4

Chain B: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	5
β-strand	6-11	6	6
β-strand	21-30	10	6
β-strand	31	1	5
β-strand	35-41	7	7
β-strand	44-45	2	7
β-strand	50-51	2	6
β-strand	55-56	2	6
β-strand	62-70	9	6
β-strand	78-84	7	7
β-strand	91-94	4	7

Chain J: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	66-68	3	8
β-strand	71-75	5	8
β-strand	80	1	9
α-helix	82-91	10
β-strand	94-96	3	8
β-strand	115-116	2	10
β-strand	119-122	4	11
β-strand	127-130	4	11
β-strand	151-155	5	10
β-strand	161-165	5	10
β-strand	170	1	9
β-strand	171-172	2	10
β-strand	173-176	4	8

Chain K: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	133-135	3	8
β-strand	138-142	5	8
β-strand	147	1	12
α-helix	149-157	9
β-strand	162-163	2	8
α-helix	169-177	9
β-strand	182-188	7	13
α-helix	194	1
β-strand	195-196	2	13
β-strand	217-221	5	13
β-strand	224-228	5	13
β-strand	234	1	12
β-strand	236	1	13
β-strand	237-239	3	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H-2 class I histocompatibility antigen, D-37 alpha chain	A	protein	278	Mus musculus	P06339 (AlphaFold model)
Beta-2-microglobulin	B	protein	99	Mus musculus	P01887 (AlphaFold model)
Killer cell lectin-like receptor, subfamily D, member 1	J	protein	120	Mus musculus	E9Q3T9
Killer cell lectin-like receptor subfamily C, member 1	K	protein	117	Mus musculus	Q9WU32 (AlphaFold model)
Qdm peptide	P	protein	9	Mus musculus	P01897

Sequence of entity 1 (A), FASTA

>8UMO_1 H-2 class I histocompatibility antigen, D-37 alpha chain (chains A)
SPHSLRYFTTAVSRPGLGEPRFIIVGYVDDTQFVRFDSDAENPRMEPRARWIEQEGPEYW
ERETWKARDMGRNFRVNLRTLLGYYNQSNDESHTLQWMYGCDVGPDGRLLRGYCQEAYDG
QDYISLNEDLRSWTANDIASQISKHKSEAVDEAHQQRAYLQGPCVEWLHRYLRLGNETLQ
RSDPPKAHVTHHPRSEDEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGT
FQKWAAVVVPLGKEQYYTCHVYHEGLPEPLTLRWEPPP

Sequence of entity 2 (B), FASTA

>8UMO_2 Beta-2-microglobulin (chains B)
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDW
SFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM

Sequence of entity 3 (J), FASTA

>8UMO_3 Killer cell lectin-like receptor, subfamily D, member 1 (chains J)
CCVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWI
GMHYSEKRNAWLWEDGTVPSKDLLVLKVIRPEHCIVYSPSKSVSAESCENKNRYICKKLP

Sequence of entity 4 (K), FASTA

>8UMO_4 Killer cell lectin-like receptor subfamily C, member 1 (chains K)
HCPKEWISYSHNCYFIGMERKSWNDSLVSCISKNCSLLYIDSEEEQDFLQSLSLISWTGI
LRKGRGQPWVWKEDSIFKPKIAEILHDECNCAMMSASGLTADNCTTLHPYLCKCKFP

Sequence of entity 5 (P), FASTA

>8UMO_5 Qdm peptide (chains P)
AMAPRTLLL

Primary citation

Structure of the murine CD94-NKG2A receptor in complex with Qa-1 b presenting an MHC-I leader peptide. MacLachlan, B.J., Sullivan, L.C., Brooks, A.G. et al. FEBS J (2024) 291:1530-1544. DOI 10.1111/febs.17050 · PubMed

Other PDB entries of the same protein (UniProt P06339 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VJ6 1.9 Å, Structure of the MHC class Ib molecule Qa-1b

Browse structure collections

About this viewer

MolViewer shows 8UMO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.