Structure of Human Neurolysin in complex with angiotensin I peptide. Determined by X-ray diffraction at 2.49 Å resolution. Released 21 Aug 2024.
Explore 8VJW in 3D Show helices and sheets RCSB PDB PDBe
8VJW contains 89 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 31-53 | 23 | |
| α-helix | 62-66 | 5 | |
| α-helix | 67-84 | 18 | |
| α-helix | 86-88 | 3 | |
| α-helix | 93-114 | 22 | |
| α-helix | 117-129 | 13 | |
| α-helix | 132-134 | 3 | |
| α-helix | 137-151 | 15 | |
| α-helix | 159-184 | 26 | |
| β-strand | 189-192 | 4 | 1 |
| α-helix | 195-197 | 3 | |
| α-helix | 202-205 | 4 | |
| β-strand | 209-210 | 2 | 1 |
| β-strand | 216-219 | 4 | 1 |
| α-helix | 222-231 | 10 | |
| α-helix | 235-245 | 11 | |
| α-helix | 250-270 | 21 | |
| α-helix | 276-281 | 6 | |
| α-helix | 289-302 | 14 | |
| α-helix | 304-325 | 22 | |
| α-helix | 335-337 | 3 | |
| α-helix | 338-350 | 13 | |
| α-helix | 354-357 | 4 | |
| α-helix | 358-360 | 3 | |
| β-strand | 362 | 1 | 2 |
| α-helix | 363-377 | 15 | |
| β-strand | 380-384 | 5 | 3 |
| α-helix | 385 | 1 | |
| β-strand | 396-402 | 7 | 3 |
| β-strand | 408-415 | 8 | 3 |
| β-strand | 427-428 | 2 | 3 |
| β-strand | 432 | 1 | 3 |
| β-strand | 436 | 1 | 4 |
| β-strand | 442 | 1 | 4 |
| α-helix | 443-444 | 2 | |
| β-strand | 445-450 | 6 | 3 |
| α-helix | 453-456 | 4 | |
| α-helix | 461-462 | 2 | |
| β-strand | 463 | 1 | 2 |
| α-helix | 466-484 | 19 | |
| α-helix | 490-492 | 3 | |
| α-helix | 503-508 | 6 | |
| α-helix | 509-513 | 5 | |
| α-helix | 516-522 | 7 | |
| α-helix | 534-542 | 9 | |
| α-helix | 548-565 | 18 | |
| α-helix | 573-580 | 8 | |
| α-helix | 581-585 | 5 | |
| α-helix | 588-590 | 3 | |
| α-helix | 596-598 | 3 | |
| α-helix | 600-603 | 4 | |
| α-helix | 612-623 | 12 | |
| α-helix | 624-628 | 5 | |
| α-helix | 629-631 | 3 | |
| α-helix | 636-642 | 7 | |
| α-helix | 643-647 | 5 | |
| α-helix | 655-663 | 9 | |
| α-helix | 670-674 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 31-53 | 23 | |
| α-helix | 62-66 | 5 | |
| α-helix | 67-84 | 18 | |
| α-helix | 86-88 | 3 | |
| α-helix | 93-114 | 22 | |
| α-helix | 117-129 | 13 | |
| α-helix | 132-134 | 3 | |
| α-helix | 137-151 | 15 | |
| α-helix | 159-184 | 26 | |
| β-strand | 189-192 | 4 | 5 |
| α-helix | 195-197 | 3 | |
| α-helix | 202-205 | 4 | |
| β-strand | 210 | 1 | 5 |
| β-strand | 216-219 | 4 | 5 |
| α-helix | 222-231 | 10 | |
| α-helix | 235-245 | 11 | |
| α-helix | 250-270 | 21 | |
| α-helix | 276-281 | 6 | |
| α-helix | 289-302 | 14 | |
| α-helix | 304-325 | 22 | |
| α-helix | 335-337 | 3 | |
| α-helix | 338-350 | 13 | |
| α-helix | 354-357 | 4 | |
| α-helix | 358-360 | 3 | |
| β-strand | 362 | 1 | 6 |
| α-helix | 363-377 | 15 | |
| β-strand | 380-385 | 6 | 7 |
| β-strand | 395-402 | 8 | 7 |
| β-strand | 408-415 | 8 | 7 |
| β-strand | 427-428 | 2 | 7 |
| β-strand | 432 | 1 | 7 |
| β-strand | 436 | 1 | 8 |
| β-strand | 442 | 1 | 8 |
| α-helix | 443-444 | 2 | |
| β-strand | 445-450 | 6 | 7 |
| α-helix | 454-456 | 3 | |
| α-helix | 461-462 | 2 | |
| β-strand | 463 | 1 | 6 |
| α-helix | 466-484 | 19 | |
| α-helix | 490-492 | 3 | |
| α-helix | 503-508 | 6 | |
| α-helix | 509-513 | 5 | |
| α-helix | 516-522 | 7 | |
| α-helix | 534-542 | 9 | |
| α-helix | 548-565 | 18 | |
| α-helix | 573-580 | 8 | |
| α-helix | 581-585 | 5 | |
| α-helix | 588-590 | 3 | |
| α-helix | 596-598 | 3 | |
| α-helix | 600-603 | 4 | |
| α-helix | 612-623 | 12 | |
| α-helix | 624-628 | 5 | |
| α-helix | 629-631 | 3 | |
| α-helix | 636-642 | 7 | |
| α-helix | 643-647 | 5 | |
| α-helix | 655-663 | 9 | |
| α-helix | 670-674 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neurolysin, mitochondrial | A, B | protein | 667 | Homo sapiens | Q9BYT8 (AlphaFold model) |
| Angiotensin-1 peptide N-terminal end | C, E | protein | 4 | Homo sapiens | |
| Angiotensin-1 peptide C-terminal end | D, F | protein | 6 | Homo sapiens |
>8VJW_1 Neurolysin, mitochondrial (chains A, B) SSYTVAGRNVLRWDLSPEQIKTRTEELIVQTKQVYDAVGMLGIEEVTYENCLQALADVEV KYIVERTMLDFPQHVSSDKEVRAASTEADKRLSRFDIEMSMRGDIFERIVHLQETCDLGK IKPEARRYLEKSIKMGKRNGLHLPEQVQNEIKSMKKRMSELCIDFNKNLNEDDTFLVFSK AELGALPDDFIDSLEKTDDDKYKITLKYPHYFPVMKKCCIPETRRRMEMAFNTRCKEENT IILQQLLPLRTKVAKLLGYSTHADFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFI LNLKKKECKDRGFEYDGKINAWDLYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNTY QELLGLSFEQMTDAHVWNKSVTLYTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPG CLLPDGSRMMAVAALVVNFSQPVAGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSG TNVETDFVEVPSQMLENWVWDVDSLRRLSKHYKDGSPIADDLLEKLVASRLVNTGLLTLR QIVLSKVDQSLHTNTSLDAASEYAKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGYL WSEVFSMDMFYSCFKKEGIMNPEVGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLM SRGLHAP
>8VJW_2 Angiotensin-1 peptide N-terminal end (chains C, E) DRVY
>8VJW_3 Angiotensin-1 peptide C-terminal end (chains D, F) IHPFHL
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Structural basis of divergent substrate recognition and inhibition of human neurolysin. Shi, K., Bagchi, S., Bickel, J. et al. Sci Rep (2024) 14:18420-18420. DOI 10.1038/s41598-024-67639-w · PubMed
Other PDB entries of the same protein (UniProt Q9BYT8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8VJW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.