8VQP: Crystal Structure Analysis of EGR1-MIDN

Crystal Structure Analysis of EGR1-MIDN. Determined by X-ray diffraction at 2.52 Å resolution. Released 23 Jul 2025.

Method: X-ray diffraction
Resolution: 2.52 Å
Organism: Homo sapiens
Chains: 1
Atoms: 900
Mol. weight: 16.54 kDa
Released: 23 Jul 2025

Explore 8VQP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VQP contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
β-strand	8-17	10	1
α-helix	32-38	7
α-helix	41-49	9
β-strand	54-60	7	1
β-strand	63-71	9	1
β-strand	86-96	11	1
β-strand	99-107	9	1
α-helix	110-112	3
β-strand	113	1	2
β-strand	119	1	2
α-helix	123-137	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
EGR1-midn	A	protein	154	Homo sapiens	Q504T8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8VQP_1 EGR1-MIDN (chains A)
GPGSPPITYTGRFSLEPAPNSGNTLSRPEQSVMQALESLTETQVSDFLSGRSPLTLALRV
GDHMMFVQLQLAAQHAPPAPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPR
RDIGTILQILNDLLSATRHYQGMPPSLAQLRCHA

Primary citation

Crystal Structure Analysis of EGR1-MIDN. Seo, H.-S., Dhe-Paganon, S. To be published.

Other PDB entries of the same protein (UniProt Q504T8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9VEH 2.0 Å, The MIDN Catch-IRF4 (A8M) fusion protein
9VE3 2.1 Å, The MIDN Catch-IRF4 (V2L) fusion protein
9VE7 2.15 Å, The MIDN Catch-IRF4 (A8V) fusion protein
9VE4 2.55 Å, The MIDN Catch-IRF4 fusion protein
9MBP 2.75 Å, Substrate-engaged human 26S proteasome bound to midnolin with RPT1 at top of spiral…
9NKG 2.8 Å, Structure of substrate engaged MIDN-bound human 26S proteasome, EB-MIDN (Composite map)
9VE6 2.8 Å, The MIDN Catch-IRF4 (F6Y) fusion protein
9MBO 2.83 Å, Focused refinement of RPN1 and the C-terminal helix of midnolin in the substrate-engaged…
9VE8 2.85 Å, The MIDN Catch-IRF4 (A8L) fusion protein
9BV3 2.9 Å, M1B Midnolin-Proteasome
9NKI 2.94 Å, Structure of substrate engaged MIDN-bound human 26S proteasome, EB MIDN_UBL state…
21IK 2.99 Å, The MIDN Catch-IRF4 (V2T) fusion protein

Browse structure collections

About this viewer

MolViewer shows 8VQP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.