8VY5: Human SAE1

Crystal structure of human SAE1. Determined by X-ray diffraction at 2.01 Å resolution. Released 19 Feb 2025.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,436
Mol. weight: 71.25 kDa
Released: 19 Feb 2025

Explore 8VY5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VY5 contains 32 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	28-35	8
β-strand	38-42	5	1
α-helix	46-58	13
β-strand	62-66	5	1
β-strand	70	1	2
α-helix	71-72	2
α-helix	75-77	3
β-strand	90	1	2
α-helix	91-102	12
β-strand	107-111	5	1
α-helix	115-117	3
α-helix	120-123	4
β-strand	128-131	4	1
α-helix	136-149	14
β-strand	152-159	8	1
β-strand	160	1	3
β-strand	162-168	7	1
β-strand	171-176	6	4
β-strand	207-212	6	4
α-helix	216-220	5
α-helix	227-234	8
α-helix	239-253	15
α-helix	259-261	3
α-helix	262-279	18
α-helix	289-293	5
β-strand	298	1	3
α-helix	300-319	20
β-strand	321	1	4
α-helix	323-325	3
β-strand	328-332	5	1
β-strand	337-341	5	1

Chain B: 16 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	31-36	6
β-strand	38-42	5	5
α-helix	46-58	13
β-strand	62-66	5	5
β-strand	70	1	6
α-helix	71-72	2
α-helix	75-77	3
β-strand	90	1	6
α-helix	91-100	10
β-strand	107-111	5	5
α-helix	115-117	3
α-helix	120-123	4
β-strand	128-131	4	5
α-helix	136-148	13
β-strand	152-159	8	5
β-strand	162-168	7	5
β-strand	171	1	7
β-strand	212	1	7
α-helix	216-220	5
α-helix	239-253	15
α-helix	259-261	3
α-helix	262-280	19
α-helix	284-286	3
α-helix	289-294	6
α-helix	300-318	19
α-helix	323-325	3
β-strand	328-332	5	5
β-strand	337-341	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SUMO-activating enzyme subunit 1, N-terminally processed	A, B	protein	320	Homo sapiens	Q9UBE0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8VY5_1 SUMO-activating enzyme subunit 1, N-terminally processed (chains A, B)
GAMGSGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGL
TMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFF
TQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTETTM
VKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDS
ELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHN
NFFFFDGMKGNGIVECLGPK

Primary citation

Crystal structure of human SAE1. Yang, Y. To be published.

Other PDB entries of the same protein (UniProt Q9UBE0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QN5 1.97 Å, Crystal structure of human SUMO E1 with small unit cell parameters in the P1 21 1 space…
6XOG 1.98 Å, Structure of SUMO1-ML786519 adduct bound to SAE
6XOI 2.0 Å, Structure of SUMO1-ML00752641 adduct bound to SAE
6XOH 2.23 Å, Structure of SUMO1-ML00789344 adduct bound to SAE
1Y8Q 2.25 Å, Sumo E1 activating enzyme SAE1-SAE2-MG-ATP complex
3KYC 2.45 Å, Human SUMO E1 complex with a SUMO1-AMP mimic
6CWY 2.46 Å, Crystal structure of SUMO E1 in complex with an allosteric inhibitor
9IF6 2.51 Å, Crystal structure of human SUMO E1 with large unit cell parameters in the P1 21 1 space…
3KYD 2.61 Å, Human SUMO E1~SUMO1-AMP tetrahedral intermediate mimic
9DRJ 2.7 Å, Cryo-EM structure of a SUMO E1-E2-SUMO1 complex.
1Y8R 2.75 Å, Sumo E1 activating enzyme SAE1-SAE2-SUMO1-MG-ATP complex
6CWZ 3.1 Å, Crystal structure of apo SUMO E1

Browse structure collections

About this viewer

MolViewer shows 8VY5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.