8W1A: KSHV ORF74 Apo Dimer

Cryo-EM Structure of KSHV ORF74 Apo Dimer at 2.8A. Determined by electron microscopy at 2.89 Å resolution. Released 27 Aug 2025.

Method: Electron microscopy
Resolution: 2.89 Å
Organism: Human gammaherpesvirus 8
Chains: 2
Atoms: 4,664
Mol. weight: 84.26 kDa
Released: 27 Aug 2025

Explore 8W1A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8W1A contains 32 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	47-74	28
α-helix	76-78	3
α-helix	81-108	28
α-helix	110-112	3
α-helix	115-148	34
α-helix	154-156	3
α-helix	158-179	22
β-strand	184-187	4	1
β-strand	194-197	4	1
α-helix	201-203	3
α-helix	204-216	13
α-helix	217-221	5
α-helix	222-241	20
α-helix	251-263	13
α-helix	265-278	14
α-helix	286-317	32
α-helix	319-329	11

Chain B: 17 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	39-41	3
α-helix	47-73	27
α-helix	76-78	3
α-helix	81-108	28
α-helix	110-112	3
α-helix	115-148	34
α-helix	154-156	3
α-helix	158-179	22
β-strand	184-187	4	2
β-strand	194-197	4	2
α-helix	201-203	3
α-helix	204-216	13
α-helix	217-221	5
α-helix	222-240	19
α-helix	247-249	3
α-helix	251-263	13
α-helix	265-278	14
α-helix	286-316	31
α-helix	319-330	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
viral G-protein coupled receptor	A, B	protein	369	Human gammaherpesvirus 8	Q98146 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8W1A_1 viral G-protein coupled receptor (chains A, B)
MAAEDFLTIFLDDDESWNETLNMSGYDYSGNFSLEVSVCEMTTVVPYTWNVGILSLIFLI
NVLGNGLVTYIFCKHRSRAGAIDILLLGICLNSLCLSISLLAEVLMFLFPNIISTGLCRL
EIFFYYLYVYLDIFSVVCVSLVRYLLVAYSTRSWPKKQSLGWVLTSAAWLIALVLSGDAC
RHRSRVVDPVSKQAMCYENAGNMTADWRLHVRTVSVTAGFLLPLALLILFYALTWCVVRR
TKLQARRKVRGVIVAVVVLFFVFCFPYHVLNLLDTLLRRRWIRDSCYTRGLINVGLAVTS
LLQALYSAVVPLIYSCLGSLFRQRMYGLFQSLRQSFMSGADYKDDDDKGRPLEVLFQGPH
HHHHHHHHH

Primary citation

Structural basis for ligand promiscuity and high signaling activity of Kaposi's Sarcoma-associated Herpesvirus-encoded GPCR. Park, J.B., Sahoo, B., Sahoo, A.R. et al. Nat Commun (2025) 16:8403-8403. DOI 10.1038/s41467-025-63457-4 · PubMed

Other PDB entries of the same protein (UniProt Q98146 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8K4P 2.81 Å, Cryo-EM structure of an active Kaposi's Sarcoma-Associated Herpesvirus-G Protein-Coupled…
9EJC 2.98 Å, Cryo-EM Structure of CXCL1-KSHV ORF74-Gi-scFv16 Complex
8K4O 3.01 Å, Cryo-EM structure of Kaposi's Sarcoma-Associated Herpesvirus-G Protein-Coupled Receptor…

Browse structure collections

About this viewer

MolViewer shows 8W1A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.