Crystal structure of IRAK4 in complex with compound 4. Determined by X-ray diffraction at 1.98 Å resolution. Released 1 May 2024.
Explore 8W3W in 3D Show helices and sheets RCSB PDB PDBe
8W3W contains 76 α-helices and 72 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 166-167 | 2 | 1 |
| α-helix | 170-176 | 7 | |
| β-strand | 184 | 1 | 1 |
| α-helix | 185-187 | 3 | |
| β-strand | 191-194 | 4 | 1 |
| β-strand | 198-205 | 8 | 1 |
| β-strand | 208-215 | 8 | 1 |
| α-helix | 223-239 | 17 | |
| β-strand | 245 | 1 | 2 |
| α-helix | 246-247 | 2 | |
| β-strand | 248-252 | 5 | 1 |
| β-strand | 259-263 | 5 | 1 |
| β-strand | 269 | 1 | 2 |
| α-helix | 270-274 | 5 | |
| α-helix | 277-279 | 3 | |
| α-helix | 280-284 | 5 | |
| α-helix | 285-304 | 20 | |
| β-strand | 307-308 | 2 | 3 |
| α-helix | 314-316 | 3 | |
| β-strand | 317-319 | 3 | 2 |
| β-strand | 325-327 | 3 | 2 |
| β-strand | 334-335 | 2 | 3 |
| β-strand | 343-344 | 2 | 4 |
| α-helix | 352-354 | 3 | |
| α-helix | 357-360 | 4 | |
| β-strand | 363-364 | 2 | 4 |
| α-helix | 366-382 | 17 | |
| β-strand | 387 | 1 | 5 |
| β-strand | 391 | 1 | 6 |
| β-strand | 395 | 1 | 5 |
| α-helix | 396-398 | 3 | |
| α-helix | 399-404 | 6 | |
| α-helix | 410-412 | 3 | |
| α-helix | 423-436 | 14 | |
| α-helix | 441-443 | 3 | |
| α-helix | 445-446 | 2 | |
| α-helix | 447-458 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 166-167 | 2 | 13 |
| α-helix | 170-176 | 7 | |
| β-strand | 184 | 1 | 13 |
| α-helix | 185-187 | 3 | |
| β-strand | 191-194 | 4 | 13 |
| β-strand | 198-205 | 8 | 13 |
| β-strand | 208-215 | 8 | 13 |
| α-helix | 223-239 | 17 | |
| β-strand | 245 | 1 | 14 |
| α-helix | 246-247 | 2 | |
| β-strand | 248-252 | 5 | 13 |
| β-strand | 258-263 | 6 | 13 |
| β-strand | 269 | 1 | 14 |
| α-helix | 270-274 | 5 | |
| α-helix | 277-279 | 3 | |
| α-helix | 280-284 | 5 | |
| α-helix | 285-304 | 20 | |
| β-strand | 307-308 | 2 | 15 |
| α-helix | 314-316 | 3 | |
| β-strand | 317-319 | 3 | 14 |
| β-strand | 325-327 | 3 | 14 |
| β-strand | 334-335 | 2 | 15 |
| β-strand | 343-344 | 2 | 16 |
| α-helix | 352-354 | 3 | |
| α-helix | 357-360 | 4 | |
| β-strand | 363-364 | 2 | 16 |
| α-helix | 366-382 | 17 | |
| β-strand | 387 | 1 | 17 |
| β-strand | 391 | 1 | 12 |
| β-strand | 395 | 1 | 17 |
| α-helix | 396-398 | 3 | |
| α-helix | 399-404 | 6 | |
| α-helix | 410-412 | 3 | |
| α-helix | 423-436 | 14 | |
| α-helix | 441-443 | 3 | |
| α-helix | 445-446 | 2 | |
| α-helix | 447-458 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 166-167 | 2 | 18 |
| α-helix | 170-176 | 7 | |
| β-strand | 184 | 1 | 18 |
| α-helix | 185-187 | 3 | |
| β-strand | 191-195 | 5 | 18 |
| β-strand | 198-205 | 8 | 18 |
| β-strand | 208-214 | 7 | 18 |
| α-helix | 223-239 | 17 | |
| β-strand | 245 | 1 | 19 |
| α-helix | 246-247 | 2 | |
| β-strand | 248-252 | 5 | 18 |
| β-strand | 259-263 | 5 | 18 |
| β-strand | 269 | 1 | 19 |
| α-helix | 270-274 | 5 | |
| α-helix | 277-279 | 3 | |
| α-helix | 280-284 | 5 | |
| α-helix | 285-304 | 20 | |
| β-strand | 307-308 | 2 | 20 |
| α-helix | 314-316 | 3 | |
| β-strand | 317-319 | 3 | 19 |
| β-strand | 325-327 | 3 | 19 |
| β-strand | 334-335 | 2 | 20 |
| β-strand | 343-344 | 2 | 21 |
| α-helix | 352-354 | 3 | |
| α-helix | 357-360 | 4 | |
| β-strand | 363-364 | 2 | 21 |
| α-helix | 366-382 | 17 | |
| β-strand | 387 | 1 | 22 |
| β-strand | 391 | 1 | 6 |
| β-strand | 395 | 1 | 22 |
| α-helix | 396-398 | 3 | |
| α-helix | 399-404 | 6 | |
| α-helix | 410-412 | 3 | |
| α-helix | 423-436 | 14 | |
| α-helix | 441-443 | 3 | |
| α-helix | 445-446 | 2 | |
| α-helix | 447-458 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-1 receptor-associated kinase 4 | A, B, C, D | protein | 323 | Homo sapiens | Q9NWZ3 (AlphaFold model) |
>8W3W_1 Interleukin-1 receptor-associated kinase 4 (chains A, B, C, D) MHHHHHHGGENLYFQGENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGF GVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDD LCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANI LLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVL LEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCL HEKKNKRPDIKKVQQLLQEMTAS
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1AFO | 7-methoxy-1-{[(2S)-5-oxopyrrolidin-2-yl]methoxy}isoquinoline-6-carboxamide | C16 H17 N3 O4 | 4 |
In Retrospect: Root-Cause Analysis of Structure-Activity Relationships in IRAK4 Inhibitor Zimlovisertib (PF-06650833). Wright, S.W., Farley, K.A., Han, S. et al. ACS Med Chem Lett (2024) 15:540-545. DOI 10.1021/acsmedchemlett.4c00036 · PubMed
Other PDB entries of the same protein (UniProt Q9NWZ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8W3W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.