Crystal structure of PDE5A in complex with CVT-313. Determined by X-ray diffraction at 1.85 Å resolution. Released 22 Nov 2023.
Explore 8W4S in 3D Show helices and sheets RCSB PDB PDBe
8W4S contains 19 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 538-545 | 8 | |
| α-helix | 551-554 | 4 | |
| α-helix | 568-581 | 14 | |
| α-helix | 584-587 | 4 | |
| α-helix | 592-604 | 13 | |
| α-helix | 615-629 | 15 | |
| α-helix | 635-637 | 3 | |
| α-helix | 640-652 | 13 | |
| α-helix | 680-694 | 15 | |
| α-helix | 706-722 | 17 | |
| α-helix | 725-740 | 16 | |
| α-helix | 749-764 | 16 | |
| α-helix | 766-769 | 4 | |
| α-helix | 772-786 | 15 | |
| α-helix | 813-820 | 8 | |
| α-helix | 821-825 | 5 | |
| α-helix | 826-835 | 10 | |
| α-helix | 837-839 | 3 | |
| α-helix | 840-858 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cGMP-specific 3',5'-cyclic phosphodiesterase | A | protein | 347 | Homo sapiens | O76074 (AlphaFold model) |
>8W4S_1 cGMP-specific 3',5'-cyclic phosphodiesterase (chains A) MGSSHHHHHHSSGLVPRGSHMEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETAL CTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGK IQNKLTDLEILALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMIL NSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKE LFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKI PSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNRQKWQALAEQQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| AJR | 2,2'-{[6-{[(4-methoxyphenyl)methyl]amino}-9-(propan-2-yl)-9H-purin-2-yl]azanedi… | C20 H28 N6 O3 | 1 |
| ZN | Zinc ion | Zn | 1 |
| MG | Magnesium ion | Mg | 1 |
Drug repurposing and structure-based discovery of new PDE4 and PDE5 inhibitors. Liu, J., Zhang, X., Chen, G. et al. Eur J Med Chem (2023) 262:115893-115893. DOI 10.1016/j.ejmech.2023.115893 · PubMed
Other PDB entries of the same protein (UniProt O76074 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8W4S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.