8W6L: SLA-2*1001 allele and ASFV antigenic peptide

Crystal structure of the SLA-2*1001 allele and ASFV antigenic peptide at 2.2A resolution. Determined by X-ray diffraction at 2.03 Å resolution. Released 7 Aug 2024.

Method: X-ray diffraction
Resolution: 2.03 Å
Organisms: Sus scrofa, Asfivirus
Chains: 3
Atoms: 3,159
Mol. weight: 44.29 kDa
Released: 7 Aug 2024

Explore 8W6L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8W6L contains 14 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-14	11	1
β-strand	19-28	10	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-52	3
α-helix	57-84	28
β-strand	94-102	9	1
β-strand	103	1	2
β-strand	109	1	2
β-strand	113-118	6	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-149	12
α-helix	152-159	8
α-helix	160-164	5
α-helix	165-174	10
α-helix	176-179	4
α-helix	181-185	5
β-strand	186-192	7	3
β-strand	199-208	10	3
β-strand	214-219	6	4
β-strand	223	1	4
α-helix	225-227	3
β-strand	229-230	2	3
α-helix	231-233	3
β-strand	234-235	2	3
β-strand	241-249	9	3
α-helix	254-256	3
β-strand	257-262	6	4
β-strand	270-272	3	4

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	5
α-helix	4-5	2
β-strand	6-11	6	6
β-strand	21-30	10	6
β-strand	31	1	5
β-strand	36-41	6	7
β-strand	44-45	2	7
α-helix	46	1
β-strand	49-50	2	6
α-helix	51-53	3
β-strand	54-55	2	6
β-strand	61-69	9	6
β-strand	77-82	6	7
β-strand	90-93	4	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MHC class I antigen	A	protein	275	Sus scrofa	B1A9P1 (AlphaFold model)
Beta-2-microglobulin	B	protein	98	Sus scrofa	Q07717 (AlphaFold model)
Thr-met-tyr-ser-leu-gly-tyr-ile-phe	C	protein	9	Asfivirus	Q89702 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8W6L_1 MHC class I antigen (chains A)
GPHSLSYFYTAVSRPDRGDSRFFIVGYVDDTQFVRFDSDAPNAKMEPRAQWIQQEGQEYW
DRETQISKDNAQINRVNLNTLRGYYNQSEAGSHTLQRMYGCYLGPDGLLLRGYDQDAYDG
ADYIALNEDLRSWTAADMAAQISKRKREAADEAERMRSYLQGRCVEWLQKYLEMGKDTLQ
RAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLSWQREGQDQSQDMELVETRPSGDGT
FQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD

Sequence of entity 2 (B), FASTA

>8W6L_2 Beta-2-microglobulin (chains B)
VARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWS
FYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH

Sequence of entity 3 (C), FASTA

>8W6L_3 THR-MET-TYR-SER-LEU-GLY-TYR-ILE-PHE (chains C)
TMYSLGYIF

Primary citation

Crystal structure of the SLA-2*1001 allele and ASFV antigenic peptide at 2.2A resolution. Wang, S. To be published.

Other PDB entries of the same protein (UniProt B1A9P1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8JV0 2.2 Å, Crystal structure of the SLA-2*1001 allele and ASFV antigenic peptide at 2.2A resolution

Browse structure collections

About this viewer

MolViewer shows 8W6L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.