HUMAN SQUALENE SYNTHASE IN COMPLEX WITH (1S,3R)-3-[2-Chloro-5-(2,2-dimethyl-propyl)-13-(2-methoxy-phenyl)-6,8-dioxo-5,6,7,8,10,11-hexahydro-13H-12-oxa-5,9-diaza-benzocycloundecen-9-yl]-cyclohexanecarboxylic acid. Determined by X-ray diffraction at 2.0 Å resolution. Released 22 May 2024.
Explore 8WTR in 3D Show helices and sheets RCSB PDB PDBe
8WTR contains 24 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 38-51 | 14 | |
| α-helix | 52-54 | 3 | |
| α-helix | 55-59 | 5 | |
| α-helix | 65-84 | 20 | |
| α-helix | 90-103 | 14 | |
| α-helix | 120-123 | 4 | |
| α-helix | 125-133 | 9 | |
| α-helix | 137-157 | 21 | |
| α-helix | 165-172 | 8 | |
| α-helix | 173-177 | 5 | |
| α-helix | 178-189 | 12 | |
| α-helix | 195-199 | 5 | |
| α-helix | 201-218 | 18 | |
| α-helix | 220-225 | 6 | |
| α-helix | 233-236 | 4 | |
| α-helix | 243-247 | 5 | |
| α-helix | 249-251 | 3 | |
| α-helix | 252-267 | 16 | |
| α-helix | 270-278 | 9 | |
| α-helix | 283-303 | 21 | |
| α-helix | 307-310 | 4 | |
| α-helix | 318-327 | 10 | |
| α-helix | 331-347 | 17 | |
| α-helix | 356-367 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Squalene synthase | A | protein | 340 | Homo sapiens | P37268 (AlphaFold model) |
>8WTR_1 Squalene synthase (chains A) MDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISV EKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM GIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLF LQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHI PDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATN MPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQN
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
| KV3 | (1~{S},3~{R})-3-[(10~{S})-13-chloranyl-2-(2,2-dimethylpropyl)-10-(2-methoxyphen… | C31 H39 Cl N2 O6 | 1 |
Discovery of Novel 11-Membered Templates as Squalene Synthase Inhibitors. Haginoya, N., Suzuki, M., Suzuki, M. et al. J Med Chem (2024) 67:5305-5314. DOI 10.1021/acs.jmedchem.3c01500 · PubMed
Other PDB entries of the same protein (UniProt P37268 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8WTR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.