8WWX: Ubiquitin-like modifier-activating enzyme 7

Ube1L acts akin to a mitt, that mediates UbcH8 binding and orchestrates "E1-E2" interaction. Determined by solution NMR. Released 8 Nov 2023.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 724
Mol. weight: 10.26 kDa
Released: 8 Nov 2023

Explore 8WWX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WWX contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
α-helix	9-15	7
α-helix	16-20	5
β-strand	26-28	3	1
β-strand	33	1	1
α-helix	42-47	6
α-helix	52-60	9
α-helix	62-64	3
β-strand	70-73	4	2
β-strand	74-76	3	1
α-helix	86-88	3
β-strand	89-92	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like modifier-activating enzyme 7	A	protein	93	Homo sapiens	P41226 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8WWX_1 Ubiquitin-like modifier-activating enzyme 7 (chains A)
PAGQPERTLESLLAHLQEQHGLRVRILLHGSALLYAAGWSPEKQAQHLPLRVTELVQQLT
GQAPAPGQRVLVLELSCEGDDEDTAFPPLHYEL

Primary citation

Dynamic Hotspots in the Uba7 Ubiquitin-Fold Domain Direct UbcH8 Recognition. Dag, C., Lambert, M., Kazar, A.E. et al. Biochemistry (2026) 65:678-692. DOI 10.1021/acs.biochem.5c00807 · PubMed

Other PDB entries of the same protein (UniProt P41226 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SE9 3.2 Å, Cryo-EM structure of a double loaded human UBA7-UBE2L6-ISG15 thioester mimetic complex…
8SEB 3.24 Å, Cryo-EM structure of a single loaded human UBA7-UBE2L6-ISG15 adenylate complex
8SV8 3.38 Å, Cryo-EM structure of a double loaded human UBA7-UBE2L6-ISG15 thioester mimetic complex…
8SEA 3.4 Å, Cryo-EM structure of a double loaded human UBA7-UBE2L6-ISG15 thioester mimetic complex…
8OIF 3.5 Å, Structure of the UBE1L activating enzyme bound to ISG15 and UBE2L6

Browse structure collections

About this viewer

MolViewer shows 8WWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.