8X3S: Human WDR5

Crystal structure of human WDR5 in complex with PTEN. Determined by X-ray diffraction at 1.87 Å resolution. Released 29 May 2024.

Method: X-ray diffraction
Resolution: 1.87 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,554
Mol. weight: 37.94 kDa
Released: 29 May 2024

Explore 8X3S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8X3S contains 0 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	9-14	6	1
β-strand	21-26	6	2
β-strand	32-37	6	2
β-strand	42-46	5	2
β-strand	52-56	5	2
β-strand	63-68	6	3
β-strand	74-79	6	3
β-strand	83-88	6	3
β-strand	94-99	6	3
β-strand	105-110	6	4
β-strand	116-121	6	4
β-strand	126-130	5	4
β-strand	136-140	5	4
β-strand	147-152	6	5
β-strand	158-163	6	5
β-strand	168-172	5	5
β-strand	178-182	5	5
β-strand	190-195	6	6
β-strand	201-206	6	6
β-strand	210-215	6	6
β-strand	220-225	6	6
β-strand	237-240	4	7
β-strand	246-249	4	7
β-strand	256-260	5	7
β-strand	266-270	5	7
β-strand	277-282	6	1
β-strand	288-293	6	1
β-strand	300-304	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
WD repeat-containing protein 5	A	protein	314	Homo sapiens	P61964 (AlphaFold model)
Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN	B	protein	34	Homo sapiens	P60484 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8X3S_1 WD repeat-containing protein 5 (chains A)
SSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFE
KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ
SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDT
ASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKY
CIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAA
LENDKTIKLWKSDC

Sequence of entity 2 (B), FASTA

>8X3S_2 Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (chains B)
SSSRRSSHYPAAVQSQAAAERGASATAKSRAISI

Primary citation

The NTE domain of PTEN alpha / beta promotes cancer progression by interacting with WDR5 via its SSSRRSS motif. Huang, X., Zhang, C., Shang, X. et al. Cell Death Dis (2024) 15:335-335. DOI 10.1038/s41419-024-06714-6 · PubMed

Other PDB entries of the same protein (UniProt P61964 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6E1Z 1.1 Å, Displacement of WDR5 from chromatin by a pharmacological WIN site inhibitor with…
6U6W 1.2 Å, Discovery and optimization of salicyclic acid-derived sulfonamide inhibitors of the…
6E1Y 1.22 Å, Discovery of Potent 2-Aryl-6,7-Dihydro-5HPyrrolo[ 1,2-a]imidazoles as WDR5 WIN-site…
6UHZ 1.26 Å, WDR5 in complex with Myc site fragment inhibitor
6UHY 1.26 Å, WDR5 in complex with Myc site fragment inhibitor
7BED 1.26 Å, X-ray structure of WDR5 bound to the WDR5 win motif peptide
6U8B 1.26 Å, Discovery and optimization of salicyclic acid-derived sulfonamide inhibitors of the…
24XP 1.3 Å, Crystal structure of WDR5 F133A variant in complex with MBD3C
4ERY 1.3 Å, X-ray structure of WDR5-MLL3 Win motif peptide binary complex
8G3E 1.33 Å, Crystal structure of human WDR5 in complex with (1M)-N-[(3,5-difluoro[1,1'-biphenyl]-4-yl…
3EMH 1.37 Å, Structural basis of WDR5-MLL interaction
3UVK 1.4 Å, Crystal structure of WDR5 in complex with the WDR5-interacting motif of MLL2

Browse structure collections

About this viewer

MolViewer shows 8X3S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.