Ckappa domain of human immunoglobulin. Determined by solution NMR. Released 5 Feb 2025.
Explore 8XKJ in 3D Show helices and sheets RCSB PDB PDBe
8XKJ contains 5 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-10 | 4 | 1 |
| α-helix | 11-13 | 3 | |
| α-helix | 14-18 | 5 | |
| β-strand | 21-22 | 2 | 2 |
| β-strand | 25-28 | 4 | 1 |
| β-strand | 37-42 | 6 | 3 |
| β-strand | 45-46 | 2 | 3 |
| β-strand | 51 | 1 | 4 |
| α-helix | 54 | 1 | |
| β-strand | 55 | 1 | 1 |
| α-helix | 56-58 | 3 | |
| β-strand | 67-70 | 4 | 1 |
| β-strand | 71 | 1 | 4 |
| β-strand | 73-74 | 2 | 2 |
| α-helix | 75-79 | 5 | |
| β-strand | 83-89 | 7 | 3 |
| β-strand | 100-102 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Immunoglobulin kappa light chain | A | protein | 111 | Homo sapiens | P0DOX7 (AlphaFold model) |
>8XKJ_1 Immunoglobulin kappa light chain (chains A) VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGESENLYFQ
Identification of potential C1-binding sites in the immunoglobulin CL domains. Yanaka, S., Kodama, A., Nishiguchi, S. et al. Int Immunol (2024) 36:405-412. DOI 10.1093/intimm/dxae017 · PubMed
Other PDB entries of the same protein (UniProt P0DOX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8XKJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.