8Y1B: Spike glycoprotein

1up-2 conformation of HKU1-B S protein after incubation of the receptor. Determined by electron microscopy at 2.8 Å resolution. Released 1 May 2024.

Method: Electron microscopy
Resolution: 2.8 Å
Organism: Human coronavirus HKU1 (isolate N2)
Chains: 3
Atoms: 29,541
Mol. weight: 450.02 kDa
Ligands: NAG
Released: 1 May 2024

Explore 8Y1B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Y1B contains 120 α-helices and 266 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 40 helices, 88 β-strands

Element	Residues	Length	Sheet
α-helix	32-34	3
β-strand	38-39	2	1
β-strand	49	1	2
β-strand	54-55	2	3
β-strand	59-67	9	4
α-helix	68-69	2
β-strand	73-74	2	1
β-strand	76	1	5
α-helix	87-90	4
β-strand	96-97	2	6
β-strand	101-107	7	5
β-strand	109-113	5	7
β-strand	116-120	5	7
β-strand	124-127	4	6
β-strand	136-141	6	6
β-strand	146-151	6	6
β-strand	155	1	8
β-strand	161-162	2	9
β-strand	175	1	8
β-strand	183-189	7	6
β-strand	197-205	9	5
β-strand	208-214	7	5
β-strand	220	1	2
β-strand	221-227	7	5
β-strand	234-237	4	6
β-strand	240-241	2	9
β-strand	256-260	5	5
β-strand	262-270	9	4
β-strand	276-281	6	4
α-helix	287-294	8
α-helix	299-300	2
β-strand	302-307	6	10
β-strand	319	1	11
α-helix	325-327	3
β-strand	337-339	3	12
β-strand	345-349	5	13
β-strand	353-354	2	13
α-helix	356-362	7
β-strand	365-371	7	13
α-helix	375-378	4
β-strand	382-392	11	13
α-helix	395-400	6
α-helix	408-412	5
β-strand	415	1	14
β-strand	422-430	9	13
β-strand	435-437	3	12
α-helix	443-447	5
β-strand	459-463	5	15
β-strand	466-468	3	16
β-strand	473	1	17
β-strand	477	1	18
α-helix	478	1
α-helix	482-484	3
β-strand	492	1	18
β-strand	494	1	19
α-helix	495-496	2
α-helix	499	1
β-strand	500	1	17
α-helix	501-502	2
β-strand	504-507	4	20
β-strand	515-518	4	20
α-helix	530-532	3
β-strand	536-538	3	16
β-strand	542	1	14
β-strand	550-551	2	21
α-helix	553-555	3
β-strand	556	1	22
β-strand	558	1	18
β-strand	564	1	19
β-strand	567	1	22
α-helix	569-571	3
β-strand	572-573	2	21
β-strand	575-579	5	15
β-strand	581-582	2	13
β-strand	585-597	13	13
β-strand	602-604	3	13
β-strand	616	1	23
β-strand	618	1	23
β-strand	619-624	6	11
β-strand	627-636	10	11
β-strand	647-649	3	11
β-strand	655-659	5	11
β-strand	666-670	5	11
α-helix	671-673	3
β-strand	676-681	6	10
β-strand	689-693	5	10
α-helix	697-699	3
α-helix	700-704	5
β-strand	712-715	4	10
β-strand	718-721	4	10
β-strand	724-731	8	24
β-strand	737-739	3	24
β-strand	742-746	5	24
β-strand	762-767	6	24
β-strand	773-775	3	25
β-strand	786-804	19	26
β-strand	809-812	4	27
α-helix	814-818	5
α-helix	823-829	7
α-helix	830-832	3
α-helix	835-861	27
β-strand	866-868	3	28
β-strand	878-879	2	29
β-strand	882-883	2	29
α-helix	885-887	3
α-helix	902-908	7
α-helix	915-922	8
α-helix	934-940	7
β-strand	943-946	4	27
α-helix	947-948	2
α-helix	952-964	13
α-helix	979-988	10
α-helix	994-999	6
α-helix	1001-1016	16
α-helix	1024-1044	21
α-helix	1045-1048	4
α-helix	1058-1062	5
α-helix	1067-1109	43
α-helix	1110-1114	5
β-strand	1129-1137	9	26
β-strand	1140-1159	20	26
β-strand	1162-1164	3	30
β-strand	1168-1172	5	30
β-strand	1175-1180	6	26
β-strand	1183-1188	6	26
β-strand	1195	1	26
β-strand	1202-1205	4	30
β-strand	1213-1214	2	30

Chain B: 37 helices, 86 β-strands

Element	Residues	Length	Sheet
β-strand	46	1	31
β-strand	48	1	31
β-strand	49	1	32
β-strand	54-55	2	11
β-strand	59-67	9	33
α-helix	68-69	2
β-strand	76	1	34
β-strand	80-81	2	35
α-helix	88-90	3
β-strand	96-97	2	36
β-strand	101-107	7	34
β-strand	109-112	4	37
β-strand	117-120	4	37
β-strand	124-127	4	36
β-strand	136-141	6	36
β-strand	145-151	7	36
β-strand	155	1	38
β-strand	175	1	38
β-strand	185-190	6	36
β-strand	197-205	9	34
β-strand	208-214	7	34
β-strand	220	1	32
β-strand	221-227	7	34
β-strand	234-237	4	36
α-helix	238-239	2
β-strand	240-241	2	35
β-strand	256-260	5	34
β-strand	262-270	9	33
β-strand	276-281	6	33
α-helix	287-294	8
β-strand	302-306	5	39
β-strand	316-319	4	40
β-strand	326	1	41
α-helix	330-333	4
β-strand	337-339	3	42
β-strand	345-349	5	41
β-strand	353-354	2	41
α-helix	356-362	7
β-strand	365-371	7	41
α-helix	375-377	3
β-strand	382-392	11	41
α-helix	393-394	2
α-helix	395-400	6
α-helix	409-413	5
α-helix	415-417	3
β-strand	422-430	9	41
β-strand	435-437	3	42
α-helix	443-446	4
β-strand	459-463	5	43
β-strand	466-468	3	44
β-strand	477	1	45
α-helix	481-483	3
β-strand	487	1	46
β-strand	492	1	45
β-strand	494	1	47
α-helix	501-503	3
β-strand	504-507	4	46
β-strand	515-518	4	46
β-strand	536-538	3	44
β-strand	550-551	2	48
α-helix	553-555	3
β-strand	556	1	49
β-strand	558	1	45
β-strand	564	1	47
β-strand	567	1	49
α-helix	569-571	3
β-strand	572-573	2	48
β-strand	575-579	5	43
β-strand	581-582	2	41
β-strand	585-597	13	41
β-strand	602-604	3	41
β-strand	619-624	6	40
β-strand	627-636	10	40
β-strand	647-649	3	40
β-strand	655-659	5	40
β-strand	666-670	5	40
α-helix	671-673	3
β-strand	677-681	5	39
β-strand	689-693	5	39
α-helix	697-699	3
α-helix	700-704	5
β-strand	712-714	3	39
β-strand	718-721	4	39
β-strand	724-731	8	50
β-strand	737-739	3	50
β-strand	742-746	5	50
β-strand	762-767	6	50
β-strand	773-775	3	51
β-strand	782	1	52
β-strand	785	1	52
β-strand	786-804	19	53
β-strand	809-812	4	54
α-helix	814-818	5
α-helix	823-830	8
α-helix	836-862	27
β-strand	866-868	3	25
β-strand	878-879	2	55
β-strand	882-883	2	55
α-helix	902-909	8
α-helix	915-922	8
α-helix	923-925	3
α-helix	934-940	7
β-strand	943-946	4	54
α-helix	947-948	2
α-helix	952-964	13
α-helix	972-974	3
α-helix	979-988	10
α-helix	994-999	6
α-helix	1001-1016	16
α-helix	1024-1044	21
α-helix	1045-1048	4
α-helix	1058-1062	5
α-helix	1071-1109	39
α-helix	1110-1114	5
β-strand	1129-1137	9	53
β-strand	1140-1159	20	53
β-strand	1162-1164	3	56
β-strand	1168-1172	5	56
β-strand	1175-1180	6	53
β-strand	1183-1188	6	53
β-strand	1195	1	53
β-strand	1202-1205	4	56
β-strand	1213-1214	2	56

Chain C: 43 helices, 92 β-strands

Element	Residues	Length	Sheet
β-strand	18	1	57
β-strand	25-26	2	58
α-helix	31-34	4
β-strand	38-39	2	59
β-strand	49	1	60
β-strand	54-55	2	40
β-strand	59-67	9	61
α-helix	68-69	2
β-strand	73-74	2	59
β-strand	75-76	2	62
β-strand	85-86	2	58
α-helix	87-90	4
β-strand	96-97	2	63
β-strand	101-107	7	62
β-strand	109-112	4	64
β-strand	117-120	4	64
β-strand	124-127	4	63
β-strand	136-141	6	63
β-strand	145-151	7	63
β-strand	155	1	65
β-strand	156	1	57
β-strand	161-162	2	66
β-strand	175	1	65
β-strand	183-190	8	63
β-strand	197-205	9	62
β-strand	208-214	7	62
β-strand	220	1	60
β-strand	221-227	7	62
β-strand	234-237	4	63
β-strand	240-241	2	66
β-strand	256-260	5	62
β-strand	262-270	9	61
β-strand	276-281	6	61
α-helix	286-294	9
β-strand	302-305	4	67
β-strand	309-310	2	68
α-helix	311-313	3
β-strand	316-319	4	3
β-strand	326	1	69
α-helix	329-333	5
β-strand	337-339	3	70
α-helix	341-343	3
β-strand	345-349	5	69
β-strand	352-354	3	69
α-helix	356-360	5
β-strand	364-371	8	69
α-helix	375-377	3
β-strand	382-392	11	69
α-helix	393-394	2
α-helix	398-401	4
α-helix	409-412	4
α-helix	415-417	3
β-strand	422-430	9	69
α-helix	431-433	3
β-strand	435-437	3	70
α-helix	443-446	4
β-strand	459-463	5	71
β-strand	466-468	3	72
β-strand	477	1	73
α-helix	479-481	3
β-strand	492	1	73
β-strand	494	1	74
α-helix	495-496	2
β-strand	505-507	3	75
β-strand	515-517	3	75
α-helix	524-526	3
β-strand	536-538	3	72
α-helix	540-541	2
β-strand	550-551	2	76
α-helix	553-555	3
β-strand	556	1	77
β-strand	558	1	73
β-strand	564	1	74
β-strand	567	1	77
α-helix	569-571	3
β-strand	572-573	2	76
β-strand	575-579	5	71
β-strand	581-582	2	69
β-strand	585-597	13	69
β-strand	602-604	3	69
α-helix	613-615	3
β-strand	616	1	3
β-strand	619-624	6	3
β-strand	627-636	10	3
β-strand	647-649	3	3
β-strand	655-659	5	3
β-strand	666-670	5	3
α-helix	671-673	3
β-strand	674-675	2	68
β-strand	678-681	4	67
β-strand	689-693	5	67
α-helix	697-699	3
α-helix	700-704	5
β-strand	712-714	3	67
β-strand	718-721	4	67
β-strand	724-731	8	78
β-strand	737-739	3	78
β-strand	742-746	5	78
β-strand	762-767	6	78
β-strand	773-775	3	28
β-strand	782	1	79
β-strand	785	1	79
β-strand	786-804	19	80
β-strand	809-812	4	81
α-helix	814-818	5
α-helix	823-829	7
α-helix	830-832	3
α-helix	835-862	28
β-strand	866-868	3	51
β-strand	878-879	2	82
β-strand	882-883	2	82
α-helix	902-909	8
α-helix	915-922	8
α-helix	923-925	3
α-helix	934-940	7
β-strand	943-946	4	81
α-helix	947-948	2
α-helix	952-964	13
α-helix	979-988	10
α-helix	994-999	6
α-helix	1001-1016	16
α-helix	1024-1044	21
α-helix	1045-1047	3
α-helix	1058-1061	4
α-helix	1067-1109	43
α-helix	1110-1114	5
β-strand	1129-1137	9	80
β-strand	1140-1159	20	80
β-strand	1162-1164	3	83
β-strand	1168-1172	5	83
β-strand	1175-1180	6	80
β-strand	1183-1188	6	80
β-strand	1195	1	80
β-strand	1202-1205	4	83
β-strand	1213-1214	2	83

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spike glycoprotein	A, B, C	protein	1290	Human coronavirus HKU1 (isolate N2)	Q14EB0

Sequence of entity 1 (A, B, C), FASTA

>8Y1B_1 Spike glycoprotein (chains A, B, C)
MFLIIFILPTTLAVIGDFNCTNSFINDYNKTIPRISEDVVDVSLGLGTYYVLNRVYLNTT
LLFTGYFPKSGANFRDLALKGSKYLSTLWYKPPFLSDFNNGIFSKVKNTKLYVNNTLYSE
FSTIVIGSVFVNTSYTIVVQPHNGILEITACQYTMCEYPHTVCKSKGSIRNESWHIDSSE
PLCLFKKNFTYNVSADWLYFHFYQERGVFYAYYADVGMPTTFLFSLYLGTILSHYYVMPL
TCKAISSNTDNETLEYWVTPLSRRQYLLNFDEHGVITNAVDCSSSFLSEIQCKTQSFAPN
TGVYDLSGFTVKPVATVYRRIPNLPDCDIDNWLNNVSVPSPLNWERRIFSNCNFNLSTLL
RLVHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDISS
SSCQLYYSLPLVNVTINNFNPSSWNRRYGFGSFNVSSYDVVYSDHCFSVNSDFCPCADPS
VVNSCVKSKPLSAICPAGTKYRHCDLDTTLYVNNWCRCSCLPDPISTYSPNTCPQKKVVV
GIGEHCPGLGINEEKCGTQLNHSSCSCSPDAFLGWSFDSCISNNRCNIFSNFIFNGINSG
TTCSNDLLYSNTEVSTGVCVNYDLYGITGQGIFKEVSAAYYNNWQNLLYDSNGNIIGFKD
FLTNKTYTILPCYSGRVSAAFYQNSSSPALLYRNLKCSYVLNNISFISQPFYFDSYLGCV
LNAVNLTSYSVSSCDLRMGSGFCIDYALPSSGSASRGISSPYRFVTFEPFNVSFVNDSVE
TVGGLFEIQIPTNFTIAGHEEFIQTSSPKVTIDCSAFVCSNYAACHDLLSEYGTFCDNIN
SILNEVNDLLDITQLQVANALMQGVTLSSNLNTNLHSDVDNIDFKSLLGCLGSQCGSSSR
SLLEDLLFNKVKLSDVGFVEAYNNCTGGSEIRDLLCVQSFNGIKVLPPILSETQISGYTT
AATVAAMFPPWSAAAGVPFSLNVQYRINGLGVTMDVLNKNQKLIANAFNKALLSIQNGFT
ATNSALAKIQSVVNANAQALNSLLQQLFNKFGAISSSLQEILSRLDPPEAQVQIDRLING
RLTALNAYVSQQLSDITLIKAGASRAIEKVNECVKSQSPRINFCGNGNHILSLVQNAPYG
LLFIHFSYKPTSFKTVLVSPGLCLSGDRGIAPKQGYFIKQNDSWMFTGSSYYYPEPISDK
NVVFMNSCSVNFTKAPFIYLNNSIPNLSDFEAEFSLWFKNHTSIAPNLTFNSHINATFLD
LYYEMNVIQESIKSLNSSFINLKEIGTYEM

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	51

Primary citation

Structural basis for the recognition of HCoV-HKU1 by human TMPRSS2. Xia, L., Zhang, Y., Zhou, Q. Cell Res (2024) 34:526-529. DOI 10.1038/s41422-024-00958-9 · PubMed

Other PDB entries of the same protein (UniProt Q14EB0), best resolution first:

8Y19 2.3 Å, Closed conformation of HKU1-B S protein after incubation of the receptor
8Y1D 2.7 Å, 2up-TM conformation of HKU1-B S protein after incubation of the receptor
8Y1E 2.7 Å, 3up-TM conformation of HKU1-B S protein after incubation of the receptor
8Y1A 2.8 Å, 1up-1 conformation of HKU1-B S protein after incubation of the receptor
8Y1C 2.8 Å, 2up-1 conformation of HKU1-B S protein after incubation of the receptor
8Y1F 2.8 Å, The closed conformation of the HKU1-B S protein in the apo state
8Y1G 2.99 Å, The 1up conformation of the HKU1-B S protein in the apo state
8Y1H 3.16 Å, The 2up formation of the HKU1-B S protein in the apo state

Browse structure collections

About this viewer

MolViewer shows 8Y1B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.