The Crystal Structure of the Type I TGF beta receptor from Biortus. Determined by X-ray diffraction at 1.4 Å resolution. Released 13 Mar 2024.
Explore 8YHF in 3D Show helices and sheets RCSB PDB PDBe
8YHF contains 18 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 202-204 | 3 | |
| β-strand | 205-213 | 9 | 1 |
| β-strand | 218-224 | 7 | 1 |
| β-strand | 227-234 | 8 | 1 |
| α-helix | 236-238 | 3 | |
| α-helix | 239-249 | 11 | |
| β-strand | 259 | 1 | 2 |
| β-strand | 262-269 | 8 | 1 |
| β-strand | 274-281 | 8 | 1 |
| β-strand | 287 | 1 | 2 |
| α-helix | 288-294 | 7 | |
| β-strand | 297 | 1 | 3 |
| α-helix | 299-317 | 19 | |
| β-strand | 320 | 1 | 4 |
| β-strand | 326 | 1 | 4 |
| β-strand | 329-330 | 2 | 5 |
| α-helix | 336-338 | 3 | |
| β-strand | 339-341 | 3 | 2 |
| β-strand | 347-349 | 3 | 2 |
| β-strand | 356-357 | 2 | 5 |
| β-strand | 358-359 | 2 | 6 |
| β-strand | 364-365 | 2 | 6 |
| α-helix | 369-370 | 2 | |
| α-helix | 376-378 | 3 | |
| α-helix | 381-384 | 4 | |
| α-helix | 393-413 | 21 | |
| β-strand | 415 | 1 | 3 |
| β-strand | 417 | 1 | 7 |
| β-strand | 420 | 1 | 7 |
| α-helix | 422-424 | 3 | |
| α-helix | 438-442 | 5 | |
| α-helix | 443-447 | 5 | |
| α-helix | 456-459 | 4 | |
| α-helix | 462-474 | 13 | |
| α-helix | 479-481 | 3 | |
| α-helix | 483-484 | 2 | |
| α-helix | 485-497 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TGF-beta receptor type-1 | A | protein | 343 | Homo sapiens | P36897 (AlphaFold model) |
>8YHF_1 TGF-beta receptor type-1 (chains A) GEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVW RGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVS DYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNIL VKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRAD IYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQS CEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1D6I | Vactosertib | C22 H18 F N7 | 1 |
The Crystal Structure of the Type I TGF beta receptor from Biortus. Wang, F., Cheng, W., Lv, Z. et al. To be published.
Other PDB entries of the same protein (UniProt P36897 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8YHF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.