The Crystal Structure of Tgf-Beta Type I Receptor (Alk5) from Biortus. Determined by X-ray diffraction at 1.47 Å resolution. Released 13 Mar 2024.
Explore 8YHL in 3D Show helices and sheets RCSB PDB PDBe
8YHL contains 19 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 202-204 | 3 | |
| β-strand | 205-213 | 9 | 1 |
| β-strand | 218-224 | 7 | 1 |
| β-strand | 227-234 | 8 | 1 |
| α-helix | 236-238 | 3 | |
| α-helix | 239-249 | 11 | |
| β-strand | 259 | 1 | 2 |
| β-strand | 262-269 | 8 | 1 |
| β-strand | 274-281 | 8 | 1 |
| β-strand | 287 | 1 | 2 |
| α-helix | 288-294 | 7 | |
| β-strand | 297 | 1 | 3 |
| α-helix | 299-317 | 19 | |
| β-strand | 320 | 1 | 4 |
| β-strand | 326 | 1 | 4 |
| β-strand | 329-330 | 2 | 5 |
| α-helix | 336-338 | 3 | |
| β-strand | 339-341 | 3 | 2 |
| β-strand | 347-349 | 3 | 2 |
| α-helix | 352-354 | 3 | |
| β-strand | 356-357 | 2 | 5 |
| β-strand | 358-359 | 2 | 6 |
| β-strand | 364-365 | 2 | 6 |
| α-helix | 369-370 | 2 | |
| α-helix | 376-378 | 3 | |
| α-helix | 381-384 | 4 | |
| α-helix | 393-412 | 20 | |
| β-strand | 415 | 1 | 3 |
| β-strand | 417 | 1 | 7 |
| β-strand | 420 | 1 | 7 |
| α-helix | 422-424 | 3 | |
| α-helix | 438-442 | 5 | |
| α-helix | 443-447 | 5 | |
| α-helix | 456-459 | 4 | |
| α-helix | 462-474 | 13 | |
| α-helix | 479-481 | 3 | |
| α-helix | 483-484 | 2 | |
| α-helix | 485-498 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TGF-beta receptor type-1 | A | protein | 306 | Homo sapiens | P36897 (AlphaFold model) |
>8YHL_1 TGF-beta receptor type-1 (chains A) GGTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHE NILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLH MEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKR YMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPS VEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQ QEGIKM
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1D6I | Vactosertib | C22 H18 F N7 | 1 |
Water and common crystallization additives (ACY, EDO) are not listed.
The Crystal Structure of Tgf-Beta Type I Receptor (Alk5) from Biortus. Wang, F., Cheng, W., Lv, Z. et al. To be published.
Other PDB entries of the same protein (UniProt P36897 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8YHL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.