8YSY: Ubiquitin

Ubiquitin(native) from Oryza sativa subsp. japonica (Rice). Determined by solution NMR. Released 9 Oct 2024.

Method: Solution NMR
Organism: Oryza sativa Japonica Group
Chains: 1
Atoms: 607
Mol. weight: 8.67 kDa
Released: 9 Oct 2024

Explore 8YSY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YSY contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	13-18	6	1
β-strand	23	1	2
α-helix	24-35	12
β-strand	42-46	5	1
β-strand	49-50	2	1
α-helix	51-52	2
β-strand	56	1	2
β-strand	66-72	7	1
α-helix	73-76	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin	A	protein	77	Oryza sativa Japonica Group	P69326 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8YSY_1 Ubiquitin (chains A)
MMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
NIQKESTLHLVLRLRGG

Primary citation

Slow Conformational Exchange between Partially Folded and Near-Native States of Ubiquitin: Evidence for a Multistate Folding Model. Adhada, S.T., Sarma, S.P. Biochemistry (2024) 63:2565-2579. DOI 10.1021/acs.biochem.4c00321 · PubMed

Other PDB entries of the same protein (UniProt P69326 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NYA 2.06 Å, Crystal Structure of ubiquitin E1 (Uba1) in complex with Ubc3 (Cdc34) and ubiquitin
7SOL 2.25 Å, Crystal Structures of the bispecific ubiquitin/FAT10 activating enzyme, Uba6
7K5J 3.42 Å, Structure of an E1-E2-ubiquitin thioester mimetic
5TTE 3.5 Å, Crystal Structure of an RBR E3 ubiquitin ligase in complex with an E2-Ub thioester…
8YUM Ubiquitin(late folding intermediate, F') from Oryza sativa subsp. japonica (Rice)

Browse structure collections

About this viewer

MolViewer shows 8YSY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.