Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound. Determined by X-ray diffraction at 1.77 Å resolution. Released 9 Apr 2025.
Explore 8YWU in 3D Show helices and sheets RCSB PDB PDBe
8YWU contains 18 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 206-217 | 12 | |
| α-helix | 222-228 | 7 | |
| α-helix | 238 | 1 | |
| β-strand | 239-241 | 3 | 1 |
| α-helix | 244-254 | 11 | |
| α-helix | 268-292 | 25 | |
| α-helix | 297-299 | 3 | |
| α-helix | 302-321 | 20 | |
| α-helix | 322-324 | 3 | |
| β-strand | 325 | 1 | 1 |
| β-strand | 329-332 | 4 | 1 |
| β-strand | 337-340 | 4 | 1 |
| α-helix | 341-345 | 5 | |
| α-helix | 348 | 1 | |
| α-helix | 351-353 | 3 | |
| α-helix | 356-366 | 11 | |
| α-helix | 372-383 | 12 | |
| α-helix | 394-415 | 22 | |
| α-helix | 422-450 | 29 | |
| α-helix | 455-457 | 3 | |
| α-helix | 458-464 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 143-148 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peroxisome proliferator-activated receptor alpha | A | protein | 272 | Homo sapiens | Q07869 (AlphaFold model) |
| Peroxisome proliferator-activated receptor gamma coactivator 1-alpha | B | protein | 22 | Homo sapiens | Q9UBK2 (AlphaFold model) |
>8YWU_1 Peroxisome proliferator-activated receptor alpha (chains A) GGQTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVA KLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEA IFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDIS LFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQL VTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
>8YWU_2 Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (chains B) PQEAEEPSLLKKLLLAPANTQL
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1LZ9 | 1-(4-fluorophenyl)-6-[2-[(5-methyl-2-phenyl-1,3-oxazol-4-yl)methoxy]ethyl]-3-pe… | C31 H31 F N4 O4 | 1 |
Structural evolution of 1H-pyrazolo[3,4-b]pyridine-derived PPARalpha activators as leads for nonalcoholic steatohepatitis. Tachibana, K., Morie, T., Fukuda, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q07869 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8YWU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.