8Z22: Liprin-alpha2/RIM1 complex

Crystal structure of the liprin-alpha2/RIM1 complex. Determined by X-ray diffraction at 2.75 Å resolution. Released 2 Apr 2025.

Method: X-ray diffraction
Resolution: 2.75 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 4
Atoms: 3,852
Mol. weight: 64.96 kDa
Released: 2 Apr 2025

Explore 8Z22 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Z22 contains 12 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	1169-1172	4	1
β-strand	1183-1191	9	2
β-strand	1194-1203	10	2
α-helix	1205-1208	4
α-helix	1214-1215	2
β-strand	1216-1225	10	1
β-strand	1228-1234	7	1
α-helix	1235-1237	3
β-strand	1245-1252	8	2
β-strand	1259-1268	10	1
β-strand	1276-1284	9	1
α-helix	1285-1287	3
β-strand	1294-1299	6	2
β-strand	1301	1	1
α-helix	1303-1306	4
β-strand	1309-1311	3	1

Chain B: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	1169-1172	4	3
β-strand	1183-1191	9	4
β-strand	1194-1203	10	4
α-helix	1205-1208	4
α-helix	1213-1215	3
β-strand	1216-1225	10	3
β-strand	1228-1234	7	3
α-helix	1235-1237	3
β-strand	1245-1252	8	4
β-strand	1260-1268	9	3
β-strand	1276-1284	9	3
α-helix	1285-1287	3
β-strand	1294-1299	6	4
β-strand	1301	1	3
α-helix	1303-1306	4
β-strand	1309-1311	3	3

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	310-400	91

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	311-399	89

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulating synaptic membrane exocytosis 1	A, B	protein	175	Rattus norvegicus	A0A8I6GEN0 (AlphaFold model)
Liprin-alpha-2	C, D	protein	111	Homo sapiens	O75334 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8Z22_1 Regulating synaptic membrane exocytosis 1 (chains A, B)
HMGSEFGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYV
KVYLLENGACIAKKKTRIARKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMG
VAQILLEELDLSSMVIGWYKLFPPSSLVDPTLAPLTRRASQSSLESSSGPPCIRS

Sequence of entity 2 (C, D), FASTA

>8Z22_2 Liprin-alpha-2 (chains C, D)
GPGSEFEVEQEAETARKDLIKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQRE
STSIHDMNDKLENELANKEAILRQMEEKNRQLQERLELAEQKLQQTMRKAE

Primary citation

The liprin-alpha /RIM complex regulates the dynamic assembly of presynaptic active zones via liquid-liquid phase separation. Jin, G., Campos, J., Liu, Y. et al. PLoS Biol (2025) 23:e3002817-e3002817. DOI 10.1371/journal.pbio.3002817 · PubMed

Browse structure collections

About this viewer

MolViewer shows 8Z22 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.