8ZIP: Mouse left ventricle actin and myosin complex

Mouse left ventricle actin and myosin complex. Determined by electron microscopy at 4.9 Å resolution. Released 29 Jan 2025.

Method: Electron microscopy
Resolution: 4.9 Å
Organism: Mus musculus
Chains: 2
Atoms: 8,662
Mol. weight: 129.35 kDa
Ligands: ADP
Released: 29 Jan 2025

Explore 8ZIP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZIP contains 58 α-helices and 52 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 34 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	7-12	6
α-helix	13-16	4
α-helix	20-26	7
β-strand	37-39	3	7
β-strand	47-49	3	7
β-strand	62-64	3	8
β-strand	68-70	3	8
β-strand	77-78	2	7
α-helix	79-81	3
α-helix	82-84	3
β-strand	89	1	9
α-helix	90-92	3
α-helix	98-110	13
β-strand	115-118	4	9
β-strand	121-125	5	9
α-helix	137-140	4
α-helix	154-168	15
β-strand	172-177	6	10
α-helix	184-198	15
α-helix	217-231	15
β-strand	233-234	2	11
β-strand	242-243	2	11
β-strand	245-253	9	10
β-strand	259-269	11	10
α-helix	271-274	4
α-helix	285-291	7
α-helix	296-301	6
α-helix	308-310	3
α-helix	327-339	13
α-helix	345-360	16
β-strand	365-367	3	12
α-helix	368	1
β-strand	374-376	3	12
α-helix	380-389	10
α-helix	393-401	9
β-strand	404-407	4	13
β-strand	410-413	4	13
α-helix	418-447	30
β-strand	456-463	8	10
α-helix	474-504	31
α-helix	517-520	4
α-helix	531-540	10
α-helix	546-557	12
β-strand	558	1	14
β-strand	561	1	14
β-strand	564-565	2	15
β-strand	571	1	16
β-strand	573	1	16
α-helix	574-576	3
β-strand	578-582	5	15
β-strand	585-589	5	15
α-helix	594-598	5
β-strand	599	1	17
α-helix	604-610	7
α-helix	616-621	6
β-strand	648	1	17
α-helix	649-665	17
β-strand	668-672	5	10
β-strand	673-675	3	9
α-helix	688-698	11
α-helix	700-707	8
β-strand	713-715	3	18
α-helix	717-723	7
α-helix	744-749	6
β-strand	765-767	3	18

Chain J: 24 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	1
β-strand	18-23	6	1
β-strand	31-34	4	1
β-strand	37-40	4	2
β-strand	55-56	2	2
α-helix	59-62	4
α-helix	64-66	3
β-strand	67-70	4	2
β-strand	73	1	3
β-strand	78	1	3
α-helix	81-90	10
α-helix	91-96	6
α-helix	100-102	3
β-strand	105-109	5	1
α-helix	115-128	14
β-strand	133-138	6	1
α-helix	139-147	9
β-strand	152-157	6	4
β-strand	162-168	7	4
β-strand	171-172	2	4
α-helix	174-176	3
β-strand	178-180	3	4
α-helix	184-194	11
α-helix	195-198	4
α-helix	205-218	14
α-helix	225-234	10
β-strand	240-243	4	5
β-strand	245	1	6
β-strand	247	1	6
β-strand	249-252	4	5
α-helix	255-258	4
α-helix	260-263	4
α-helix	266-269	4
α-helix	276-285	10
α-helix	292-295	4
β-strand	299-302	4	4
α-helix	304-306	3
α-helix	311-322	12
β-strand	331-332	2	4
α-helix	337-339	3
α-helix	340-350	11
α-helix	352-354	3
β-strand	359-360	2	1
α-helix	361-367	7
α-helix	371-375	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin, alpha cardiac muscle 1	J	protein	370	Mus musculus	P68033 (AlphaFold model)
Myosin-6	C	protein	772	Mus musculus	Q02566 (AlphaFold model)

Sequence of entity 1 (J), FASTA

>8ZIP_1 Actin, alpha cardiac muscle 1 (chains J)
TTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI
LTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMF
ETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRD
LTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPD
GQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTT
MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE
AGPSIVHRKC

Sequence of entity 2 (C), FASTA

>8ZIP_2 Myosin-6 (chains C)
AQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEYVKAKVVSREGGKVTAET
ENGKTVTIKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCV
TVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAG
KTVNTKRVIQYFASIAAIGDRSKKENPNANKGTLEDQIIQANPALEAFGNAKTVRNDNSS
RFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLL
VTNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLSFTAEEKAGVYKLTGAIMHYGNM
KFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYY
SIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTN
EKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPK
ASDMTFKAKLYDNHLGKSNNFQKPRNVKGKQEAHFSLVHYAGTVDYNIMGWLEKNKDPLN
ETVVGLYQKSSLKLMATLFSTYASADTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTN
LKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQR
YRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLL

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Primary citation

Mouse left ventricle actin and myosin complex. Li, D.N., Zhao, Q.Y., Liu, C. To be published.

Other PDB entries of the same protein (UniProt P68033 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ZBN 3.02 Å, Mouse MYH6 R404Q left ventricle ATM complex
8ZIU 3.54 Å, Mouse MYH6 R404Q left ventricle actin and myosin complex
9E2E 4.0 Å, The structure of the junction region of the wild-type murine native cardiac thin…
8ZBK 4.28 Å, Mouse left ventricle ATM complex
9MOW 4.9 Å, Structure of native murine cardiac thin filament variant I79N in troponin T at pCa=5.8…
9MOP 5.0 Å, Structure of native murine cardiac thin filament variant I79N in troponin T at pCa=5.8…
9MOM 5.1 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-bound partially…
9MO7 5.2 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-bound fully…
9MO8 5.2 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-free state (upper…
9MOL 5.2 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-free tilted state…
9MON 5.2 Å, Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-bound fully…
9MOO 5.2 Å, Structure of native murine cardiac thin filament variant I79N in troponin T at pCa=5.8…

Browse structure collections

About this viewer

MolViewer shows 8ZIP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.