8ZJX: Full length pAg-bound BTN2A1-BTN3A1-BTN3A2

Cryo-EM structure of the full length pAg-bound BTN2A1-BTN3A1-BTN3A2 in complex with Vgamma9-Vdelta2 TCR (MOP genotype). Determined by electron microscopy at 3.35 Å resolution. Released 26 Nov 2025.

Method: Electron microscopy
Resolution: 3.35 Å
Organism: Homo sapiens
Chains: 6
Atoms: 17,386
Mol. weight: 285.82 kDa
Ligands: H6P
Released: 26 Nov 2025

Explore 8ZJX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZJX contains 40 α-helices and 179 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	31-33	3	1
β-strand	39	1	2
β-strand	49-54	6	1
β-strand	63-67	5	3
β-strand	77-78	2	4
β-strand	83-84	2	4
α-helix	90-92	3
β-strand	96-98	3	1
β-strand	107-112	6	1
β-strand	123-128	6	3
β-strand	133-138	6	3
β-strand	140	1	2
β-strand	150-152	3	5
β-strand	156-157	2	5
β-strand	160-170	11	5
β-strand	175-179	5	6
β-strand	185-186	2	6
β-strand	190-195	6	5
β-strand	201-209	9	5
β-strand	216-222	7	6
β-strand	229-235	7	6
α-helix	250-321	72
β-strand	325-327	3	7
β-strand	332	1	8
α-helix	334-336	3
β-strand	341-343	3	7
β-strand	349-352	4	7
β-strand	374-376	3	9
β-strand	377	1	8
β-strand	381	1	9
β-strand	385-391	7	7
β-strand	398-404	7	9
α-helix	417-419	3
β-strand	421-427	7	9
β-strand	430-432	3	9
β-strand	440	1	9
β-strand	449-455	7	7
α-helix	456-458	3
β-strand	460-465	6	7
β-strand	470-474	5	7
α-helix	475-477	3
β-strand	484-490	7	9
β-strand	497-499	3	7
α-helix	500-503	4
β-strand	516	1	7

Chain B: 9 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	31-33	3	10
α-helix	38	1
β-strand	39-42	4	11
β-strand	47-51	5	12
β-strand	52-54	3	10
β-strand	63-67	5	11
β-strand	74	1	13
β-strand	76-78	3	11
β-strand	83	1	11
α-helix	85-87	3
β-strand	88	1	13
α-helix	90-92	3
β-strand	96-102	7	12
α-helix	103-105	3
β-strand	107-112	6	12
α-helix	117-119	3
β-strand	121-129	9	11
β-strand	132-143	12	11
β-strand	144	1	14
α-helix	147-149	3
β-strand	150-156	7	15
β-strand	161-170	10	15
β-strand	171	1	14
β-strand	175-179	5	16
β-strand	190-195	6	15
β-strand	201-209	9	15
β-strand	216-223	8	16
β-strand	228-235	8	16
α-helix	251-321	71
β-strand	325-327	3	7
β-strand	332	1	17
β-strand	341	1	18
β-strand	349-350	2	7
β-strand	352	1	18
β-strand	374-376	3	19
β-strand	377	1	17
β-strand	381	1	19
β-strand	385-391	7	7
β-strand	398-404	7	19
β-strand	421-427	7	19
β-strand	430-432	3	19
β-strand	440-441	2	19
β-strand	449-455	7	7
β-strand	460-465	6	7
β-strand	470-474	5	7
α-helix	475-477	3
β-strand	484-489	6	19
β-strand	497-499	3	7
α-helix	500-503	4
β-strand	516-517	2	7

Chain D: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	20
β-strand	19-22	4	21
α-helix	30-32	3
β-strand	33-40	8	20
β-strand	46-51	6	20
β-strand	55-56	2	20
α-helix	57	1
β-strand	64-69	6	21
β-strand	74-79	6	21
β-strand	88-96	9	20
α-helix	97-98	2
β-strand	99	1	22
β-strand	109-118	10	20
α-helix	119-122	4
β-strand	126	1	23
β-strand	129-135	7	24
β-strand	138-146	9	24
β-strand	147	1	23
β-strand	152-156	5	25
β-strand	160-163	4	24
β-strand	167-170	4	24
β-strand	176-184	9	24
β-strand	191-195	5	25
β-strand	200-202	3	25

Chain E: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	32-34	3	26
β-strand	40-43	4	22
β-strand	48-55	8	26
β-strand	64-69	6	22
β-strand	75-79	5	22
β-strand	84-85	2	22
β-strand	97-103	7	26
α-helix	104-106	3
β-strand	108-113	6	26
β-strand	122-130	9	22
β-strand	133-144	12	22
β-strand	145	1	27
α-helix	148-150	3
β-strand	151-157	7	28
β-strand	161-171	11	28
β-strand	172	1	27
β-strand	176-180	5	29
α-helix	185	1
β-strand	186-187	2	29
α-helix	188	1
β-strand	190-191	2	28
α-helix	192-194	3
β-strand	195	1	28
β-strand	202-211	10	28
β-strand	218-224	7	29
β-strand	229-237	9	29
α-helix	239-241	3
α-helix	246-253	8
α-helix	256-321	66

Chain F: 7 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	32	1	30
β-strand	40-43	4	31
β-strand	48-50	3	32
β-strand	55	1	30
β-strand	64-69	6	31
β-strand	74-80	7	31
β-strand	83-85	3	31
α-helix	91-93	3
β-strand	99-103	5	32
α-helix	104-106	3
β-strand	108-113	6	32
β-strand	122-130	9	31
β-strand	133-144	12	31
α-helix	148-150	3
β-strand	151-158	8	29
β-strand	161-167	7	29
β-strand	176-181	6	28
β-strand	187	1	28
β-strand	191	1	29
β-strand	194-195	2	33
β-strand	203-204	2	33
β-strand	206-210	5	29
β-strand	218-223	6	28
β-strand	230-237	8	28
α-helix	240-242	3
α-helix	246-318	73
α-helix	326-336	11
β-strand	338-339	2	34
β-strand	344	1	35
β-strand	353-355	3	36
β-strand	362-364	3	36
β-strand	383-385	3	37
β-strand	386	1	35
β-strand	390	1	37
β-strand	394-400	7	34
β-strand	407-413	7	37
α-helix	426-428	3
β-strand	430-436	7	37
β-strand	440-443	4	37
β-strand	449-450	2	37
β-strand	459-465	7	34
β-strand	470-475	6	34
β-strand	481-485	5	34
β-strand	494-499	6	37
β-strand	509-510	2	34

Chain G: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	38
β-strand	10-14	5	39
β-strand	19-26	8	38
β-strand	33-40	8	39
β-strand	46-52	7	39
β-strand	58-60	3	39
α-helix	65	1
β-strand	69-74	6	38
β-strand	79-84	6	38
α-helix	89-91	3
β-strand	93-101	9	39
β-strand	108-109	2	39
β-strand	113-118	6	39
α-helix	128	1
β-strand	129-133	5	40
β-strand	139	1	41
β-strand	142	1	41
β-strand	147-155	9	40
β-strand	160-167	8	42
β-strand	172	1	42
β-strand	176-177	2	40
β-strand	187-194	8	40
β-strand	203-210	8	42
α-helix	214-216	3
α-helix	217-218	2
β-strand	219-223	5	42

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Butyrophilin subfamily 2 member A1	A, B	protein	534	Homo sapiens	Q7KYR7 (AlphaFold model)
T cell receptor delta variable 2,T cell receptor delta constant 1	D	protein	332	Homo sapiens
Butyrophilin subfamily 3 member A2	E	protein	340	Homo sapiens	P78410 (AlphaFold model)
Butyrophilin subfamily 3 member A1	F	protein	539	Homo sapiens	O00481 (AlphaFold model)
T cell receptor gamma variable 9,T cell receptor gamma constant 1	G	protein	267	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>8ZJX_1 Butyrophilin subfamily 2 member A1 (chains A, B)
MDMRVPAQLLGLLLLWLSGARCQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRW
FRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCY
FQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVA
PALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSP
CAVALPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEE
ELQVKEKLQEELRWRRTFLHAVDVVLDPDTAHPDLFLSEDRRSVRRCPFRHLGESVPDNP
ERFDSQPCVLGRESFASGKHYWEVEVENVIEWTVGVCRDSVERKGEVLLIPQNGFWTLEM
HKGQYRAVSSPDRILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFSVPVRP
FFRLGCEDSPIFICPALTGANGVTVPEEGLTLHRVGTHQSLGSSGMDYKDDDDK

Sequence of entity 2 (D), FASTA

>8ZJX_2 T cell receptor delta variable 2,T cell receptor delta constant 1 (chains D)
MDMRVPAQLLGLLLLWLSGARCMDYKDDDDKGGSETGAIELVPEHQTVPVSIGVPATLRC
SMKGEAIGNYYINWYRKTQGNTMTFIYREKDIYGPGFKDNFQGDIDIAKNLAVLKILAPS
ERDEGSYYCACDPVVLGDTGYTDKLIFGKGTRVTVEPRSQPHTKPSVFVMKNGTNVACLV
KEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHS
TDFEVKTDSTDHVKPKETENTKQPSKSASTDTLQAETDQLEDEKYALQTEIANLLKEKEK
LGAPGTGSGSGGLNDIFEAQKIEWHEHHHHHH

Sequence of entity 3 (E), FASTA

>8ZJX_3 Butyrophilin subfamily 3 member A2 (chains E)
MDMRVPAQLLGLLLLWLSGARCQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKW
VSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCY
FQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENI
PAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQP
WIAALAGTLPILLLLLAGASYFLWRQQKEITALSSEIESEQEMKEMGYAATEREISLRES
LQEELKRKKIQYLTRGEESSSDTNKSAGSSGMDYKDDDDK

Sequence of entity 4 (F), FASTA

>8ZJX_4 Butyrophilin subfamily 3 member A1 (chains F)
MDMRVPAQLLGLLLLWLSGARCQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKW
VSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCY
FQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENI
PTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQR
WIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVK
LLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKE
PQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKGWVKMTPE
NGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLD
VSFSEALYPVFRILTLEPTALTICPAGSSGAWSHPQFEKGGGSGGGSGGSAWSHPQFEK

Sequence of entity 5 (G), FASTA

>8ZJX_5 T cell receptor gamma variable 9,T cell receptor gamma constant 1 (chains G)
MDMRVPAQLLGLLLLWLSGARCMDYKDDDDKGGSETGAGHLEQPQISSTKTLSKTARLEC
VVSGITISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLT
IHNVEKQDIATYYCALKELGKKIKVFGPGTKLIITDKQLDADVSPKPTIFLPSIAETKLQ
KAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEKSLDKE
HRCIVRHENNKNGVDQEIIFPPIKTDV

Ligands and cofactors

ID	Name	Formula	Copies
H6P	(2E)-4-hydroxy-3-methylbut-2-en-1-yl trihydrogen diphosphate	C5 H12 O8 P2	1

Primary citation

Phosphoantigen-driven dissociation of butyrophilin oligomers activates gamma delta T cells. Xin, W., Huang, B., Gao, W. et al. Cell Discov (2026) 12. DOI 10.1038/s41421-026-00911-7 · PubMed

Other PDB entries of the same protein (UniProt Q7KYR7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IGT 1.56 Å, Crystal Structure of Intracellular B30.2 Domain of BTN2A1
8DFW 2.1 Å, Crystal Structure of Human BTN2A1 in Complex With Vgamma9-Vdelta2 T Cell Receptor
8JYE 2.18 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1 and BTN2A1 in Complex with HMBPP
8JYC 2.29 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1 and BTN2A1 in Complex with DMAPP
8VC7 2.76 Å, Crystal Structure of Human BTN2A1 ectodomain in complex with Antagonist 2A1.9 Fab
8ZHR 3.0 Å, Cryo-EM structure of the full-length pAg-bound BTN2A1-BTN3A1-BTN3A2 complex
9JQR 3.0 Å, Cryo-EM structure of the Vgamma9Vdelta2 TCR-engaged BTN3A1-BTN3A2-BTN2A1 complex
9IRD 3.2 Å, Cryo-EM structure of BTN2A1-BTN3A1-BTN3A2 mutant (BTN3A1 H381R, BTN2A1 R477A/T510A) in…
9JQQ 3.26 Å, Cryo-EM structure of the HMBPP-primed BTN3A1-BTN3A2-BTN2A1 complex
9II6 3.27 Å, Cryo-EM structure of the intracellular domains of BTN2A1-BTN3A1-BTN3A3
9JQ6 3.34 Å, Cryo-EM structure of BTN2A1 in complex with antagonist antibody TH002
9JQP 3.34 Å, Cryo-EM structure of the HMBPP-primed BTN3A1-BTN3A2-BTN2A1 in complex with agonist…

Browse structure collections

About this viewer

MolViewer shows 8ZJX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.