8ZK0: Full length pAg-bound BTN2A1-BTN3A1-BTN3A2

Cryo-EM structure of the full length pAg-bound BTN2A1-BTN3A1-BTN3A2 in complex with Vgamma9-Vdelta2 TCR (G115 genotype). Determined by electron microscopy at 3.4 Å resolution. Released 26 Nov 2025.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 6
Atoms: 17,420
Mol. weight: 273.73 kDa
Ligands: H6P
Released: 26 Nov 2025

Explore 8ZK0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZK0 contains 31 α-helices and 179 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	31-33	3	1
α-helix	38	1
β-strand	39-42	4	2
β-strand	47-54	8	1
β-strand	63-67	5	3
β-strand	76-78	3	3
β-strand	83	1	3
β-strand	96-99	4	1
α-helix	103-105	3
β-strand	107-112	6	1
β-strand	123-129	7	3
β-strand	132-138	7	3
β-strand	140-143	4	2
β-strand	144	1	4
α-helix	147-149	3
β-strand	150-157	8	5
β-strand	160-170	11	5
β-strand	171	1	4
β-strand	175-179	5	6
β-strand	186	1	6
β-strand	190-192	3	5
β-strand	201-209	9	5
β-strand	216-222	7	6
β-strand	229-235	7	6
α-helix	246-321	76
β-strand	325-327	3	7
β-strand	332	1	8
β-strand	341-343	3	7
β-strand	349-352	4	7
α-helix	361-363	3
β-strand	374-376	3	9
β-strand	377	1	8
β-strand	381	1	9
β-strand	385-391	7	7
β-strand	398-404	7	9
β-strand	421-427	7	9
β-strand	430-433	4	9
β-strand	440	1	9
β-strand	449-455	7	7
β-strand	460-465	6	7
β-strand	470-474	5	7
α-helix	475-477	3
β-strand	484-490	7	9
β-strand	497-499	3	7
α-helix	500-503	4
β-strand	517	1	7

Chain B: 7 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	31-33	3	10
β-strand	39-42	4	11
β-strand	47-51	5	12
β-strand	52-54	3	10
β-strand	63-67	5	11
β-strand	74	1	13
β-strand	76-79	4	11
β-strand	82-83	2	11
β-strand	88	1	13
β-strand	96-99	4	12
β-strand	108-112	5	12
α-helix	117-119	3
β-strand	121-129	9	11
β-strand	132-143	12	11
β-strand	144	1	14
α-helix	147-149	3
β-strand	150-158	9	15
β-strand	160-170	11	15
β-strand	171	1	14
β-strand	175-179	5	16
α-helix	184-188	5
β-strand	190-195	6	15
β-strand	201-208	8	15
β-strand	216-223	8	16
β-strand	228-235	8	16
α-helix	250-321	72
β-strand	325-327	3	7
β-strand	332	1	17
α-helix	334-336	3
β-strand	341-343	3	7
β-strand	349-352	4	7
β-strand	374-376	3	18
β-strand	377	1	17
β-strand	381	1	18
β-strand	385-391	7	7
β-strand	398-404	7	18
β-strand	421-427	7	18
β-strand	430-433	4	18
β-strand	436-441	6	18
β-strand	449-455	7	7
β-strand	460-465	6	7
β-strand	470-474	5	7
α-helix	475-477	3
β-strand	484-490	7	18
β-strand	497-499	3	7
α-helix	500-503	4
β-strand	516-517	2	7

Chain D: 1 helix, 18 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	19
β-strand	19-22	4	20
α-helix	30-32	3
β-strand	33-40	8	19
β-strand	46-51	6	19
β-strand	55-56	2	19
β-strand	64-68	5	20
β-strand	75-79	5	20
β-strand	88-96	9	19
β-strand	108-109	2	19
β-strand	113-117	5	19
β-strand	128-134	7	21
β-strand	137-145	9	21
β-strand	151-155	5	22
β-strand	159-162	4	21
β-strand	166-169	4	21
β-strand	175-183	9	21
β-strand	190-195	6	22
β-strand	198-201	4	22

Chain E: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	32-34	3	28
α-helix	39	1
β-strand	40-43	4	29
β-strand	48-55	8	28
β-strand	64-69	6	29
β-strand	74-80	7	29
β-strand	83-84	2	29
α-helix	91-93	3
β-strand	97-100	4	28
α-helix	104-106	3
β-strand	108-113	6	28
α-helix	118-120	3
β-strand	122-130	9	29
β-strand	133-144	12	29
β-strand	145	1	30
β-strand	151-158	8	31
β-strand	161-171	11	31
β-strand	172	1	30
β-strand	176-180	5	32
β-strand	186	1	32
β-strand	190-191	2	31
α-helix	192-194	3
β-strand	195-196	2	31
β-strand	202-210	9	31
β-strand	218-224	7	32
β-strand	229-237	9	32
α-helix	247-321	75

Chain F: 7 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	32-34	3	33
β-strand	40-43	4	34
β-strand	48-55	8	33
β-strand	64-69	6	34
β-strand	74-79	6	34
β-strand	80	1	35
β-strand	83	1	35
α-helix	91-93	3
β-strand	97-100	4	33
β-strand	108-113	6	33
β-strand	122-130	9	34
β-strand	133-144	12	34
β-strand	145	1	36
α-helix	148-150	3
β-strand	151-154	4	32
β-strand	162-171	10	32
β-strand	172	1	36
β-strand	176-180	5	31
β-strand	186	1	31
β-strand	190	1	32
β-strand	195-196	2	32
β-strand	202-210	9	32
β-strand	218-223	6	31
β-strand	230-237	8	31
α-helix	247-318	72
α-helix	326-336	11
β-strand	338-339	2	37
β-strand	344	1	38
α-helix	346-348	3
β-strand	353-355	3	37
α-helix	356	1
β-strand	361-364	4	37
β-strand	383-385	3	39
β-strand	386	1	38
β-strand	390	1	39
β-strand	394-400	7	37
β-strand	407-413	7	39
α-helix	426-428	3
β-strand	430-436	7	39
β-strand	440-443	4	39
β-strand	449-450	2	39
β-strand	459-465	7	37
β-strand	470-475	6	37
β-strand	481-485	5	37
β-strand	494-499	6	39
β-strand	508-510	3	37

Chain G: 3 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	23
β-strand	10-13	4	24
β-strand	19-26	8	23
β-strand	35-40	6	24
β-strand	46-52	7	24
β-strand	58-60	3	24
α-helix	65	1
β-strand	69-74	6	23
β-strand	79-84	6	23
α-helix	89-91	3
β-strand	93-102	10	24
β-strand	109-113	5	24
β-strand	117-121	5	24
β-strand	133-137	5	25
β-strand	150-151	2	26
β-strand	153-159	7	25
β-strand	165-170	6	27
β-strand	176	1	27
β-strand	180-181	2	25
β-strand	185-186	2	25
β-strand	191-196	6	25
β-strand	198-199	2	26
β-strand	208-213	6	27
α-helix	218-220	3
β-strand	223-227	5	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Butyrophilin subfamily 2 member A1	A, B	protein	534	Homo sapiens	Q7KYR7 (AlphaFold model)
T cell receptor delta variable 2, T cell receptor delta constant 1	D	protein	239	Homo sapiens
T cell receptor gamma variable 9, T cell receptor gamma constant 1	G	protein	252	Homo sapiens
Butyrophilin subfamily 3 member A2	E	protein	340	Homo sapiens	P78410 (AlphaFold model)
Butyrophilin subfamily 3 member A1	F	protein	539	Homo sapiens	O00481 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8ZK0_1 Butyrophilin subfamily 2 member A1 (chains A, B)
MDMRVPAQLLGLLLLWLSGARCQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRW
FRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCY
FQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVA
PALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSP
CAVALPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEE
ELQVKEKLQEELRWRRTFLHAVDVVLDPDTAHPDLFLSEDRRSVRRCPFRHLGESVPDNP
ERFDSQPCVLGRESFASGKHYWEVEVENVIEWTVGVCRDSVERKGEVLLIPQNGFWTLEM
HKGQYRAVSSPDRILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFSVPVRP
FFRLGCEDSPIFICPALTGANGVTVPEEGLTLHRVGTHQSLGSSGMDYKDDDDK

Sequence of entity 2 (D), FASTA

>8ZK0_2 T cell receptor delta variable 2, T cell receptor delta constant 1 (chains D)
ETGAIELVPEHQTVPVSIGVPATLRCSMKGEAIGNYYINWYRKTQGNTMTFIYREKDIYG
PGFKDNFQGDIDIAKNLAVLKILAPSERDEGSYYCASDTLGMGGEYTDKLIFGKGTRVTV
EPRSQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNA
VKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSASGLVPR

Sequence of entity 3 (G), FASTA

>8ZK0_3 T cell receptor gamma variable 9, T cell receptor gamma constant 1 (chains G)
ETGAGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRERPGEVIQFLVSISYDGT
VRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWEAQQELGKKIKVFGPGT
KLIITDKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTIL
GSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITM
DPKDNASGLVPR

Sequence of entity 4 (E), FASTA

>8ZK0_4 Butyrophilin subfamily 3 member A2 (chains E)
MDMRVPAQLLGLLLLWLSGARCQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKW
VSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCY
FQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENI
PAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQP
WIAALAGTLPILLLLLAGASYFLWRQQKEITALSSEIESEQEMKEMGYAATEREISLRES
LQEELKRKKIQYLTRGEESSSDTNKSAGSSGMDYKDDDDK

Sequence of entity 5 (F), FASTA

>8ZK0_5 Butyrophilin subfamily 3 member A1 (chains F)
MDMRVPAQLLGLLLLWLSGARCQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKW
VSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCY
FQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENI
PTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQR
WIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVK
LLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKE
PQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKGWVKMTPE
NGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLD
VSFSEALYPVFRILTLEPTALTICPAGSSGAWSHPQFEKGGGSGGGSGGSAWSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
H6P	(2E)-4-hydroxy-3-methylbut-2-en-1-yl trihydrogen diphosphate	C5 H12 O8 P2	1

Primary citation

Phosphoantigen-driven dissociation of butyrophilin oligomers activates gamma delta T cells. Xin, W., Huang, B., Gao, W. et al. Cell Discov (2026) 12. DOI 10.1038/s41421-026-00911-7 · PubMed

Other PDB entries of the same protein (UniProt Q7KYR7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IGT 1.56 Å, Crystal Structure of Intracellular B30.2 Domain of BTN2A1
8DFW 2.1 Å, Crystal Structure of Human BTN2A1 in Complex With Vgamma9-Vdelta2 T Cell Receptor
8JYE 2.18 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1 and BTN2A1 in Complex with HMBPP
8JYC 2.29 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1 and BTN2A1 in Complex with DMAPP
8VC7 2.76 Å, Crystal Structure of Human BTN2A1 ectodomain in complex with Antagonist 2A1.9 Fab
8ZHR 3.0 Å, Cryo-EM structure of the full-length pAg-bound BTN2A1-BTN3A1-BTN3A2 complex
9JQR 3.0 Å, Cryo-EM structure of the Vgamma9Vdelta2 TCR-engaged BTN3A1-BTN3A2-BTN2A1 complex
9IRD 3.2 Å, Cryo-EM structure of BTN2A1-BTN3A1-BTN3A2 mutant (BTN3A1 H381R, BTN2A1 R477A/T510A) in…
9JQQ 3.26 Å, Cryo-EM structure of the HMBPP-primed BTN3A1-BTN3A2-BTN2A1 complex
9II6 3.27 Å, Cryo-EM structure of the intracellular domains of BTN2A1-BTN3A1-BTN3A3
9JQ6 3.34 Å, Cryo-EM structure of BTN2A1 in complex with antagonist antibody TH002
9JQP 3.34 Å, Cryo-EM structure of the HMBPP-primed BTN3A1-BTN3A2-BTN2A1 in complex with agonist…

Browse structure collections

About this viewer

MolViewer shows 8ZK0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.