PWWP domain from human DNMT3B. Determined by X-ray diffraction at 2.74 Å resolution. Released 2 Apr 2025.
Explore 8ZLK in 3D Show helices and sheets RCSB PDB PDBe
8ZLK contains 15 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 228-231 | 4 | 1 |
| β-strand | 239-244 | 6 | 1 |
| α-helix | 246-249 | 4 | |
| α-helix | 253-255 | 3 | |
| β-strand | 258-263 | 6 | 1 |
| β-strand | 269-273 | 5 | 1 |
| α-helix | 274-276 | 3 | |
| β-strand | 277-279 | 3 | 1 |
| α-helix | 283-286 | 4 | |
| α-helix | 289-294 | 6 | |
| α-helix | 296-313 | 18 | |
| α-helix | 325-337 | 13 | |
| α-helix | 345-348 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 228-231 | 4 | 2 |
| β-strand | 239-244 | 6 | 2 |
| α-helix | 246-249 | 4 | |
| α-helix | 253-255 | 3 | |
| β-strand | 258-263 | 6 | 2 |
| β-strand | 269-273 | 5 | 2 |
| α-helix | 274-276 | 3 | |
| β-strand | 277-279 | 3 | 2 |
| α-helix | 289-294 | 6 | |
| α-helix | 296-312 | 17 | |
| α-helix | 325-336 | 12 | |
| α-helix | 345-348 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA (cytosine-5)-methyltransferase 3B | A, B | protein | 151 | Homo sapiens | Q9UBC3 (AlphaFold model) |
>8ZLK_1 DNA (cytosine-5)-methyltransferase 3B (chains A, B) GEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWF GDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDS LEDQLKPMLEWAHGGFKPTGIEGLKPNNTQP
Histone modification-driven structural remodeling unleashes DNMT3B in DNA methylation. Cho, C.C., Huang, H.H., Jiang, B.C. et al. Sci Adv (2025) 11:eadu8116-eadu8116. DOI 10.1126/sciadv.adu8116 · PubMed
Other PDB entries of the same protein (UniProt Q9UBC3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8ZLK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.