8ZZO: Structural Model of Ghrelin

Structural Model of Ghrelin Bound to its G Protein-Coupled Receptor. Released 6 Feb 2019.

Chains

2

Atoms

2,534

Released

6 Feb 2019

Explore 8ZZO in 3D Show helices and sheets RCSB PDB PDBe

Molecules and chains

>8ZZO_1 GHSR (chains A)
MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT

>8ZZO_2 Ghrelin (chains B)
GSSFLSPEHQRVQQRKESKKPPAKLQPR

Primary citation

Structural Model of Ghrelin Bound to it G Protein-Coupled Receptor. Brian J. Bender, Gerrit Vortmeier, Stefan Ernicke et al. Structure (2019) 27:537-544. DOI 10.1016/j.str.2018.12.004

Related structures

Other PDB entries of the same protein (UniProt Q92847 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 9UY3 2.52 Å, Anamorelin bound growth hormone secretagogue receptor in complex with Gq
• 9V2N 2.63 Å, Macimorelin bound growth hormone secretagogue receptor in complex with Gq
• 7NA7 2.7 Å, Structures of human ghrelin receptor-Gi complexes with ghrelin and a synthetic agonist
• 7NA8 2.7 Å, Structures of human ghrelin receptor-Gi complexes with ghrelin and a synthetic agonist
• 7W2Z 2.8 Å, Cryo-EM structure of the ghrelin-bound human ghrelin receptor-Go complex
• 7F9Y 2.9 Å, ghrelin-bound ghrelin receptor in complex with Gq
• 8JSR 2.9 Å, Cryo-EM structure of the anamorelin-bound ghrelin receptor and Gq complex
• 7F83 2.94 Å, Crystal Structure of a receptor in Complex with inverse agonist
• 7F9Z 3.2 Å, GHRP-6-bound ghrelin receptor in complex with Gq
• 6KO5 3.3 Å, Complex structure of Ghrelin receptor with Fab

Browse structure collections

About this viewer

MolViewer shows 8ZZO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.