9A2N: P0A912

Model of E. coli Pal by in-cell photo-crosslinking MS and deep learning. Released 24 Feb 2023.

Chains

1

Atoms

1,316

Mol. weight

21.94 kDa

Released

24 Feb 2023

Explore 9A2N in 3D Show helices and sheets RCSB PDB PDBe

Molecules and chains

>9A2N_1 P0A912 (chains A)
MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARL
QMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNIS
LGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY

Primary citation

Protein structure prediction with in-cell photo-crosslinking mass spectrometry and deep learning. Stahl, K., Graziadei, A., Dau, T. et al. Nature Biotechnology (2023). DOI 10.1038/s41587-023-01704-z · PubMed

Related structures

Other PDB entries of the same protein (UniProt P0A912 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 2HQS 1.5 Å, Crystal structure of TolB/Pal complex
• 2W8B 1.86 Å, Crystal structure of processed TolB in complex with Pal
• 1OAP 1.93 Å, Mad structure of the periplasmique domain of the Escherichia coli PAL protein
• 9RLF 3.17 Å, LolCDE complex with Pal lipoprotein
• 9RLE 3.18 Å, LolCDE complex with Pal lipoprotein
• 9RLK 3.29 Å, LolCDE(delta 235-252) complex with Pal lipoprotein
• 9RLI 3.63 Å, LolCDEdelta(235-252) complex with Pal lipoprotein

Browse structure collections

About this viewer

MolViewer shows 9A2N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.