9AS7: Local refinement of 5-HT2AR

Local refinement of 5-HT2AR bound to psilocin in complex with a mini-Gq and scFv16 obtained by cryo-electron microscopy (cryoEM). Determined by electron microscopy at 2.72 Å resolution. Released 2 Apr 2025.

Method: Electron microscopy
Resolution: 2.72 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,987
Mol. weight: 52.85 kDa
Ligands: 91Q
Released: 2 Apr 2025

Explore 9AS7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9AS7 contains 15 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	82-101	20
α-helix	103-105	3
α-helix	108-122	15
α-helix	123-127	5
α-helix	128-136	9
α-helix	147-178	32
α-helix	180-186	7
α-helix	189-207	19
α-helix	209-214	6
α-helix	218-220	3
β-strand	222-223	2	1
β-strand	226-227	2	1
α-helix	232-240	9
α-helix	245-260	16
α-helix	315-348	34
α-helix	355-381	27
α-helix	385-391	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5-hydroxytryptamine receptor 2A	A	protein	471	Homo sapiens	P28223 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9AS7_1 5-hydroxytryptamine receptor 2A (chains A)
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV

Ligands and cofactors

ID	Name	Formula	Copies
91Q	3-[2-(dimethylamino)ethyl]-1~{H}-indol-4-ol	C12 H16 N2 O	1

Primary citation

The structural diversity of psychedelic drug actions revealed. Gumpper, R.H., Jain, M.K., Kim, K. et al. Nat Commun (2025) 16:2734-2734. DOI 10.1038/s41467-025-57956-7 · PubMed

Other PDB entries of the same protein (UniProt P28223 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WC8 2.45 Å, Crystal structure of serotonin 2A receptor in complex with lumateperone
7WC9 2.5 Å, Crystal structure of serotonin 2A receptor in complex with non-hallucinogenic…
9AS8 2.54 Å, Global reconstruction of 5-HT2AR bound to psilocin in complex with a mini-Gq protein and…
7WC6 2.6 Å, Crystal structure of serotonin 2A receptor in complex with LSD
7WC7 2.6 Å, Crystal structure of serotonin 2A receptor in complex with lisuride
9LL8 2.62 Å, Psilocin-bound Serotonin 2A (5-HT2A) receptor-Gi complex
8JT8 2.7 Å, Crystal structure of 5-HT2AR in complex with (R)-IHCH-7179
9LL9 2.76 Å, DOI-bound Serotonin 2A (5-HT2A) receptor-Gq complex
8UWL 2.8 Å, 5-HT2AR bound to Lisuride in complex with a mini-Gq protein and an active-state…
9J87 2.84 Å, Structure of Receptor
9LL7 2.84 Å, DOI-bound Serotonin 2A (5-HT2A) receptor-Gi complex
6A94 2.9 Å, Crystal structure of 5-HT2AR in complex with zotepine

Browse structure collections

About this viewer

MolViewer shows 9AS7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.