9AUH: CH848.d949.10.17.GS-DH270.UCA3
Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA3. Determined by electron microscopy at 3.6 Å resolution. Released 5 Feb 2025.
- Method
- Electron microscopy
- Resolution
- 3.6 Å
- Organisms
- Human immunodeficiency virus 1, Homo sapiens
- Chains
- 12
- Atoms
- 20,312
- Mol. weight
- 368.81 kDa
- Ligands
- NAG
- Released
- 5 Feb 2025
Explore 9AUH in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9AUH contains 64 α-helices and 210 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 10 helices, 46 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 35-40 | 6 | 1 |
| β-strand | 45-47 | 3 | 2 |
| β-strand | 53-56 | 4 | 3 |
| α-helix | 60-62 | 3 | |
| β-strand | 68 | 1 | 4 |
| β-strand | 75-76 | 2 | 3 |
| α-helix | 77-78 | 2 | |
| β-strand | 84-85 | 2 | 2 |
| β-strand | 91-93 | 3 | 5 |
| α-helix | 99-114 | 16 | |
| β-strand | 121 | 1 | 6 |
| α-helix | 128 | 1 | |
| β-strand | 129-130 | 2 | 7 |
| β-strand | 154-155 | 2 | 8 |
| β-strand | 158 | 1 | 7 |
| β-strand | 159-162 | 4 | 9 |
| β-strand | 169-172 | 4 | 9 |
| β-strand | 176-177 | 2 | 8 |
| α-helix | 178-180 | 3 | |
| β-strand | 181-182 | 2 | 10 |
| β-strand | 190-191 | 2 | 7 |
| β-strand | 192-193 | 2 | 10 |
| β-strand | 202 | 1 | 6 |
| β-strand | 203 | 1 | 11 |
| α-helix | 204-205 | 2 | |
| β-strand | 209 | 1 | 4 |
| β-strand | 215 | 1 | 12 |
| β-strand | 216-218 | 3 | 3 |
| β-strand | 221 | 1 | 2 |
| β-strand | 223-228 | 6 | 2 |
| β-strand | 237-239 | 3 | 5 |
| β-strand | 242-245 | 4 | 2 |
| β-strand | 247 | 1 | 3 |
| β-strand | 251 | 1 | 12 |
| α-helix | 264-266 | 3 | |
| β-strand | 271-273 | 3 | 13 |
| β-strand | 284-287 | 4 | 13 |
| β-strand | 294-297 | 4 | 14 |
| β-strand | 304-309 | 6 | 15 |
| β-strand | 315-320 | 6 | 15 |
| β-strand | 329-334 | 6 | 14 |
| α-helix | 335-349 | 15 | |
| β-strand | 357-361 | 4 | 13 |
| β-strand | 374-378 | 5 | 14 |
| β-strand | 381-385 | 5 | 14 |
| β-strand | 394-395 | 2 | 13 |
| β-strand | 413-421 | 9 | 14 |
| β-strand | 423 | 1 | 11 |
| β-strand | 435 | 1 | 11 |
| α-helix | 436-438 | 3 | |
| β-strand | 445-447 | 3 | 14 |
| β-strand | 451-456 | 6 | 13 |
| β-strand | 465-470 | 6 | 13 |
| α-helix | 476-482 | 7 | |
| β-strand | 486-491 | 6 | 2 |
| β-strand | 494-499 | 6 | 1 |
Chain B: 11 helices, 44 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 35-40 | 6 | 16 |
| β-strand | 45-47 | 3 | 17 |
| β-strand | 55-56 | 2 | 18 |
| α-helix | 58-60 | 3 | |
| α-helix | 74 | 1 | |
| β-strand | 75-76 | 2 | 18 |
| α-helix | 77-78 | 2 | |
| β-strand | 83-85 | 3 | 17 |
| β-strand | 91-94 | 4 | 19 |
| α-helix | 99-115 | 17 | |
| α-helix | 128 | 1 | |
| β-strand | 129-130 | 2 | 20 |
| β-strand | 154-155 | 2 | 21 |
| β-strand | 158 | 1 | 20 |
| β-strand | 159-162 | 4 | 22 |
| β-strand | 169-172 | 4 | 22 |
| β-strand | 176-177 | 2 | 21 |
| α-helix | 178-180 | 3 | |
| β-strand | 181-182 | 2 | 23 |
| β-strand | 190-191 | 2 | 20 |
| β-strand | 192-193 | 2 | 23 |
| β-strand | 202-203 | 2 | 24 |
| α-helix | 204-205 | 2 | |
| β-strand | 215 | 1 | 25 |
| β-strand | 216 | 1 | 18 |
| β-strand | 218 | 1 | 26 |
| α-helix | 219-220 | 2 | |
| β-strand | 223-228 | 6 | 17 |
| β-strand | 236-239 | 4 | 19 |
| β-strand | 242-245 | 4 | 17 |
| β-strand | 247 | 1 | 26 |
| β-strand | 251 | 1 | 25 |
| β-strand | 271-273 | 3 | 27 |
| β-strand | 285-287 | 3 | 27 |
| β-strand | 293-296 | 4 | 28 |
| β-strand | 304-309 | 6 | 29 |
| β-strand | 315-320 | 6 | 29 |
| β-strand | 330-334 | 5 | 28 |
| α-helix | 335-349 | 15 | |
| β-strand | 357-361 | 4 | 30 |
| β-strand | 374-378 | 5 | 31 |
| β-strand | 381-385 | 5 | 31 |
| β-strand | 393-395 | 3 | 30 |
| β-strand | 413-417 | 5 | 28 |
| β-strand | 418-419 | 2 | 31 |
| β-strand | 423-424 | 2 | 24 |
| β-strand | 434-435 | 2 | 24 |
| α-helix | 436-438 | 3 | |
| β-strand | 447-448 | 2 | 28 |
| β-strand | 451-453 | 3 | 27 |
| β-strand | 454-456 | 3 | 30 |
| β-strand | 465-470 | 6 | 30 |
| α-helix | 476-482 | 7 | |
| β-strand | 486-491 | 6 | 17 |
| β-strand | 494-499 | 6 | 16 |
Chain C: 11 helices, 42 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 35-40 | 6 | 32 |
| β-strand | 45-47 | 3 | 33 |
| α-helix | 52 | 1 | |
| β-strand | 53-56 | 4 | 34 |
| α-helix | 58-60 | 3 | |
| β-strand | 75-76 | 2 | 34 |
| β-strand | 84-85 | 2 | 33 |
| β-strand | 91-93 | 3 | 35 |
| α-helix | 99-115 | 17 | |
| α-helix | 123-125 | 3 | |
| β-strand | 129 | 1 | 36 |
| β-strand | 130 | 1 | 37 |
| β-strand | 133 | 1 | 38 |
| α-helix | 135-137 | 3 | |
| β-strand | 154-155 | 2 | 38 |
| β-strand | 158 | 1 | 37 |
| β-strand | 159-162 | 4 | 39 |
| β-strand | 169-172 | 4 | 39 |
| β-strand | 176-177 | 2 | 38 |
| β-strand | 181-183 | 3 | 36 |
| β-strand | 191-193 | 3 | 36 |
| α-helix | 194-196 | 3 | |
| β-strand | 203 | 1 | 40 |
| β-strand | 215 | 1 | 41 |
| β-strand | 216-218 | 3 | 34 |
| β-strand | 223-228 | 6 | 33 |
| β-strand | 237-239 | 3 | 35 |
| β-strand | 242-245 | 4 | 33 |
| β-strand | 247 | 1 | 34 |
| β-strand | 251 | 1 | 41 |
| β-strand | 259-260 | 2 | 42 |
| α-helix | 264-266 | 3 | |
| β-strand | 271-273 | 3 | 42 |
| β-strand | 284-297 | 14 | 42 |
| β-strand | 304-307 | 4 | 43 |
| β-strand | 317-320 | 4 | 43 |
| β-strand | 330-334 | 5 | 42 |
| α-helix | 335-349 | 15 | |
| β-strand | 357-361 | 4 | 42 |
| α-helix | 369-372 | 4 | |
| β-strand | 374-378 | 5 | 44 |
| β-strand | 381-385 | 5 | 44 |
| β-strand | 393-395 | 3 | 42 |
| β-strand | 413-417 | 5 | 42 |
| β-strand | 418-421 | 4 | 44 |
| β-strand | 423-424 | 2 | 40 |
| β-strand | 434-435 | 2 | 40 |
| α-helix | 436-438 | 3 | |
| β-strand | 444-456 | 13 | 42 |
| β-strand | 465-470 | 6 | 42 |
| α-helix | 476-482 | 7 | |
| β-strand | 486-491 | 6 | 33 |
| β-strand | 494-498 | 5 | 32 |
Chain D: 8 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 513-515 | 3 | |
| α-helix | 531-534 | 4 | |
| α-helix | 537-540 | 4 | |
| α-helix | 573-595 | 23 | |
| β-strand | 603-609 | 7 | 1 |
| α-helix | 619-625 | 7 | |
| α-helix | 628-635 | 8 | |
| α-helix | 636-638 | 3 | |
| α-helix | 639-663 | 25 | |
Chain E: 7 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 530-533 | 4 | |
| α-helix | 537-541 | 5 | |
| α-helix | 574-595 | 22 | |
| β-strand | 603-609 | 7 | 16 |
| α-helix | 610-611 | 2 | |
| α-helix | 619-625 | 7 | |
| α-helix | 628-635 | 8 | |
| α-helix | 640-663 | 24 | |
Chain F: 5 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 538-542 | 5 | |
| α-helix | 571-595 | 25 | |
| β-strand | 603-609 | 7 | 32 |
| α-helix | 619-624 | 6 | |
| α-helix | 628-635 | 8 | |
| α-helix | 640-663 | 24 | |
Chain G: 2 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-6 | 4 | 45 |
| β-strand | 10-12 | 3 | 46 |
| β-strand | 18-25 | 8 | 45 |
| α-helix | 29-31 | 3 | |
| β-strand | 32-39 | 8 | 46 |
| β-strand | 46-51 | 6 | 46 |
| β-strand | 58 | 1 | 46 |
| β-strand | 68-73 | 6 | 45 |
| β-strand | 78-83 | 6 | 45 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-101 | 10 | 46 |
| β-strand | 117 | 1 | 46 |
| β-strand | 121-125 | 5 | 46 |
Chain H: 2 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-6 | 4 | 47 |
| β-strand | 10-12 | 3 | 48 |
| β-strand | 18-25 | 8 | 47 |
| α-helix | 29-31 | 3 | |
| β-strand | 32-39 | 8 | 48 |
| β-strand | 45-51 | 7 | 48 |
| β-strand | 58 | 1 | 48 |
| β-strand | 68-69 | 2 | 47 |
| β-strand | 72-73 | 2 | 47 |
| β-strand | 78-83 | 6 | 47 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-101 | 10 | 48 |
| β-strand | 117 | 1 | 48 |
| β-strand | 121-125 | 5 | 48 |
4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| HIV-1 BG505 DS-SOSIP glycoprotein gp120 | A, B, C | protein | 469 | Human immunodeficiency virus 1 | A0A1W6IPB2 |
| HIV-1 BG505 DS-SOSIP glycoprotein gp41 | D, E, F | protein | 153 | Human immunodeficiency virus 1 | D0PUM0 |
| UCA3 heavy chain | G, H, I | protein | 232 | Homo sapiens | |
| UCA3 light chain | J, K, L | protein | 216 | Homo sapiens | |
Sequence of entity 1 (A, B, C), FASTA
>9AUH_1 HIV-1 BG505 DS-SOSIP glycoprotein gp120 (chains A, B, C)
AENLWVTVYYGVPVWKEAKTTLFCASDARAYEKEVHNVWATHACVPTDPSPQELVLGNVT
ENFNMWKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLICSDAGSGGVEEMKNCSFNTT
TEIRDKEKKEYALFYKPDIVPLSETNNTSEYRLINCNTSACTQACPKVTFEPIPIHYCAP
AGYAILKCNDETFNGTGPCSNVSTVQCTHGIRPVVSTQLLLNGSLAEKEIVIRSENLTNN
AKIIIVHLHTPVEIVCTRPNNNTRKSVRIGPGQTFYATGDIIGDIKQAHCNISEEKWNDT
LQKVGIELQKHFPNKTIKYNQSAGGDMEITTHSFNCGGEFFYCNTSNLFNGTYNGTYIST
NSSANSTSTITLQCRIKQIINMWQGVGRCMYAPPIAGNITCRSNITGLLLTRDGGTNSNE
TETFRPAGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRRVVGRRRRRR
Sequence of entity 2 (D, E, F), FASTA
>9AUH_2 HIV-1 BG505 DS-SOSIP glycoprotein gp41 (chains D, E, F)
AVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTVW
GIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQW
DKEISNYTQIIYGLLEESQNQQEKNEQDLLALD
Sequence of entity 3 (G, H, I), FASTA
>9AUH_3 UCA3 heavy chain (chains G, H, I)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNY
AQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGGWISLYYDSSGYPNFDYWGQG
TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK
Sequence of entity 4 (J, K, L), FASTA
>9AUH_4 UCA3 light chain (chains J, K, L)
QSALTQPASVSGSPGQSITISCTGTSSDVGSYNLVSWYQQHPGKAPKLMIYEVSKRPSGV
SNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSTVIFGGGTKLTVLGQPKANPTVT
LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASS
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 30 |
Primary citation
An engineered immunogen activates diverse HIV broadly neutralizing antibody precursors and promotes acquisition of improbable mutations. Swanson, O.M., Zhang, Q.E., Van Itallie, E. et al. Sci Transl Med (2025) 17:eadr2218-eadr2218. DOI 10.1126/scitranslmed.adr2218 · PubMed
Other PDB entries of the same protein (UniProt A0A1W6IPB2), best resolution first:
- 8SAU 3.3 Å, CryoEM structure of DH270.4-CH848.10.17
- 8SAW 3.3 Å, CryoEM structure of DH270.UCA.G57R-CH848.10.17DT
- 8SAY 3.4 Å, CryoEM structure of DH270.3-CH848.10.17
- 6UM7 3.5 Å, Cryo-EM structure of vaccine-elicited HIV-1 neutralizing antibody DH270.mu1 in complex…
- 8SB2 3.5 Å, CryoEM structure of DH270.I2-CH848.10.17
- 8DTO 3.57 Å, Vaccine elicited Antibody MU89 bound to CH848.D949.10.17_N133D_N138T.DS.SOSIP.664 HIV-1…
- 8SB4 3.6 Å, CryoEM structure of DH270.1-CH848.10.17
- 8VGV 3.6 Å, DH270.6 Fab bound to the HIV-1 CH848 DE3 SOSIP
- 8DOW 3.69 Å, Cryo-EM structure of HIV-1 Env(CH848 10.17 DS.SOSIP_DT) in complex with DH1030.1 Fab
- 8EU8 3.73 Å, Cryo-EM structure of CH848 10.17DT DS-SOSIP-2P Env
- 9AUG 3.8 Å, Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA3.G57R
- 9AUI 3.8 Å, Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA4
Browse structure collections
About this viewer
MolViewer shows 9AUH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.