Human alpha-galactosidase A in complex with saposin B. Determined by X-ray diffraction at 3.53 Å resolution. Released 17 Apr 2024.
Explore 9AVS in 3D Show helices and sheets RCSB PDB PDBe
9AVS contains 35 α-helices and 47 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 43-44 | 2 | 1 |
| α-helix | 47-50 | 4 | |
| α-helix | 66-78 | 13 | |
| α-helix | 81-84 | 4 | |
| β-strand | 88-89 | 2 | 1 |
| β-strand | 96 | 1 | 2 |
| β-strand | 108 | 1 | 2 |
| α-helix | 117-126 | 10 | |
| β-strand | 130-131 | 2 | 1 |
| β-strand | 132-136 | 5 | 3 |
| β-strand | 140 | 1 | 4 |
| β-strand | 146 | 1 | 4 |
| α-helix | 152-162 | 11 | |
| β-strand | 166-170 | 5 | 3 |
| α-helix | 177-192 | 16 | |
| β-strand | 199-202 | 4 | 3 |
| α-helix | 216-222 | 7 | |
| β-strand | 225-227 | 3 | 3 |
| α-helix | 231-232 | 2 | |
| α-helix | 236-248 | 13 | |
| α-helix | 250-253 | 4 | |
| β-strand | 258 | 1 | 5 |
| β-strand | 261 | 1 | 5 |
| β-strand | 262-264 | 3 | 3 |
| β-strand | 268 | 1 | 1 |
| α-helix | 277-289 | 13 | |
| β-strand | 295-296 | 2 | 1 |
| α-helix | 305-311 | 7 | |
| α-helix | 314-320 | 7 | |
| β-strand | 329-334 | 6 | 6 |
| β-strand | 337-344 | 8 | 6 |
| β-strand | 348-355 | 8 | 6 |
| β-strand | 363-368 | 6 | 7 |
| α-helix | 369-375 | 7 | |
| β-strand | 381-388 | 8 | 6 |
| β-strand | 392-398 | 7 | 6 |
| β-strand | 402-407 | 6 | 7 |
| β-strand | 409 | 1 | 6 |
| β-strand | 411-417 | 7 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 42-44 | 3 | 8 |
| α-helix | 66-78 | 13 | |
| α-helix | 81-84 | 4 | |
| β-strand | 88-89 | 2 | 8 |
| β-strand | 96 | 1 | 9 |
| β-strand | 108 | 1 | 9 |
| α-helix | 117-126 | 10 | |
| β-strand | 130-131 | 2 | 8 |
| β-strand | 132-136 | 5 | 10 |
| β-strand | 140 | 1 | 11 |
| β-strand | 146 | 1 | 11 |
| α-helix | 152-162 | 11 | |
| β-strand | 166-170 | 5 | 10 |
| α-helix | 177-194 | 18 | |
| β-strand | 199-202 | 4 | 10 |
| α-helix | 204-208 | 5 | |
| α-helix | 216-222 | 7 | |
| β-strand | 225-227 | 3 | 10 |
| α-helix | 236-248 | 13 | |
| α-helix | 250-253 | 4 | |
| β-strand | 262-264 | 3 | 10 |
| β-strand | 268 | 1 | 8 |
| α-helix | 277-289 | 13 | |
| β-strand | 294-296 | 3 | 8 |
| α-helix | 305-311 | 7 | |
| α-helix | 314-320 | 7 | |
| α-helix | 326-328 | 3 | |
| β-strand | 329-334 | 6 | 12 |
| β-strand | 337-343 | 7 | 12 |
| β-strand | 348-355 | 8 | 12 |
| β-strand | 363-368 | 6 | 13 |
| α-helix | 369-371 | 3 | |
| α-helix | 373-375 | 3 | |
| β-strand | 381-388 | 8 | 12 |
| β-strand | 392-398 | 7 | 12 |
| β-strand | 402-407 | 6 | 13 |
| β-strand | 411-418 | 8 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-19 | 15 | |
| α-helix | 25-35 | 11 | |
| α-helix | 36-39 | 4 | |
| α-helix | 44-52 | 9 | |
| α-helix | 56-64 | 9 | |
| α-helix | 67-74 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alpha-galactosidase A | A, B | protein | 414 | Homo sapiens | P06280 (AlphaFold model) |
| Saposin-B | C | protein | 82 | Homo sapiens | P07602 (AlphaFold model) |
>9AVS_1 Alpha-galactosidase A (chains A, B) LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGY YDIDAQTFADWGVDLLKFAGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPF QKPNYTEIRQYCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIG NFGLSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQL RQGDNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVK RKLGFYEWTSRLRSHINPTGTVLLQLENTMQMSLKDLLDYKDDDDKDYKDDDDK
>9AVS_2 Saposin-B (chains C) GASGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEI AIQMMMHMQPKEICALVGFCDE
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Water and common crystallization additives (SO4) are not listed.
Human Saposin B Ligand Binding and Presentation to alpha-Galactosidase A. Sawyer, T.K., Aral, E., Staros, J.V. et al. bioRxiv (2024). DOI 10.1101/2024.04.04.584535 · PubMed
Other PDB entries of the same protein (UniProt P06280 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9AVS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.