9BPM: Cardiac muscle alpha-actin A331P hcm mutant

cryo-EM structure of cardiac muscle alpha-actin A331P hcm mutant. Determined by electron microscopy at 3.42 Å resolution. Released 14 May 2025.

Method: Electron microscopy
Resolution: 3.42 Å
Organism: Homo sapiens
Chains: 4
Atoms: 11,740
Mol. weight: 169.28 kDa
Ligands: MG, ADP
Released: 14 May 2025

Explore 9BPM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BPM contains 92 α-helices and 76 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 23 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
β-strand	17-21	5	1
β-strand	29-31	3	1
β-strand	35-38	4	2
β-strand	53-54	2	2
α-helix	56-60	5
β-strand	65-68	4	2
β-strand	71-72	2	3
β-strand	75-76	2	3
α-helix	79-87	9
α-helix	88-92	5
α-helix	98-100	3
β-strand	103-107	5	1
α-helix	113-122	10
α-helix	123-127	5
β-strand	131-136	6	1
α-helix	137-144	8
β-strand	150-155	6	4
β-strand	160-166	7	4
β-strand	169-170	2	4
α-helix	172-174	3
β-strand	176-178	3	4
α-helix	182-193	12
α-helix	194-196	3
α-helix	206-216	11
α-helix	224-232	9
β-strand	238-242	5	5
β-strand	245-250	6	5
α-helix	252-254	3
α-helix	258-261	4
α-helix	264-266	3
α-helix	274-283	10
α-helix	290-294	5
β-strand	297-300	4	4
α-helix	302-304	3
α-helix	309-320	12
β-strand	329-330	2	4
α-helix	338-346	9
α-helix	350-354	5
β-strand	357-358	2	1
α-helix	359-365	7
α-helix	369-372	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin, alpha cardiac muscle 1	A, B, C, D	protein	375	Homo sapiens	A0A8W4F696 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9BPM_1 Actin, alpha cardiac muscle 1 (chains A, B, C, D)
DDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT
QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDL
AGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIPPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDEAGPSIVHRKCF

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	4

Primary citation

CRYO-EM STRUCTURE OF CARDIAC MUSCLE ALPHA-ACTIN A331P HCM MUTANT. Huang, H.L., Heissler, S.M., Chinthalapudi, K. To be published.

Other PDB entries of the same protein (UniProt A0A8W4F696 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UWW 5.1 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free state from…
8V0K 5.2 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound partially…
8UYD 5.3 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free state from…
8UZY 5.3 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound partially…
8UZX 5.4 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound fully…
8UWY 5.5 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free rotated…
8V01 5.5 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound fully…
8V0I 5.8 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound fully…
8UZ5 5.9 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free rotated…
8UWX 6.0 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free tilted…
8V0Y 7.0 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free state from…
8UZ6 7.1 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free tilted…

Browse structure collections

About this viewer

MolViewer shows 9BPM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.