9BS9: Local refinement of DRD2

Local refinement of DRD2 bound to LSD in complex with a mini-GoA and scFv16 obtained by cryo-electron microscopy (cryoEM). Determined by electron microscopy at 2.28 Å resolution. Released 17 Sept 2025.

Method: Electron microscopy
Resolution: 2.28 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 1
Atoms: 2,008
Mol. weight: 67.56 kDa
Ligands: 7LD
Released: 17 Sept 2025

Explore 9BS9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BS9 contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	36-61	26
α-helix	68-82	15
α-helix	83-87	5
α-helix	88-97	10
α-helix	104-137	34
α-helix	139-143	5
α-helix	145-167	23
α-helix	168-172	5
α-helix	187-194	8
α-helix	195-199	5
α-helix	200-222	23
α-helix	366-397	32
α-helix	405-427	23
α-helix	431-438	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble cytochrome b562,D(2) dopamine receptor	R	protein	588	Escherichia coli, Homo sapiens	P14416 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>9BS9_1 Soluble cytochrome b562,D(2) dopamine receptor (chains R)
DYKDDDDAKLQTMHHHHHHHHHHHHHHHADLEDNWETLNDNLKVIEKADNAAQVKDALTK
MRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAE
QLKTTRNAYIQKYLASENLYFQGGTMDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYN
YYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLE
VVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVM
ISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIV
LRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARR
AQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHP
KIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHIL
NIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

Ligands and cofactors

ID	Name	Formula	Copies
7LD	(8alpha)-N,N-diethyl-6-methyl-9,10-didehydroergoline-8-carboxamide	C20 H25 N3 O	1

Primary citation

The polypharmacology of psychedelics reveals multiple targets for potential therapeutics. Jain, M.K., Gumpper, R.H., Slocum, S.T. et al. Neuron (2025) 113:3129-3142.e9. DOI 10.1016/j.neuron.2025.06.012 · PubMed

Other PDB entries of the same protein (UniProt P14416 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AER 2.19 Å, Neuronal calcium sensor-1 (NCS-1)from Rattus norvegicus complex with D2 dopamine…
9BSB 2.32 Å, Global reconstruction of DRD2 bound to LSD in complex with a mini-GoA and scFv16…
7JVR 2.8 Å, Cryo-EM structure of Bromocriptine-bound dopamine receptor 2 in complex with Gi protein
6CM4 2.87 Å, Structure of the D2 Dopamine Receptor Bound to the Atypical Antipsychotic Drug Risperidone
8IRS 3.0 Å, Dopamine Receptor D2R-Gi-Rotigotine complex
6LUQ 3.1 Å, Haloperidol bound D2 dopamine receptor structure inspired discovery of subtype selective…
7DFP 3.1 Å, Human dopamine D2 receptor in complex with spiperone
8TZQ 3.2 Å, CryoEM structure of D2 dopamine receptor in complex with GoA KE Mutant, scFv16, and…
8U02 3.28 Å, CryoEM structure of D2 dopamine receptor in complex with GoA KE mutant and dopamine
6VMS 3.8 Å, Structure of a D2 dopamine receptor-G-protein complex in a lipid membrane

Browse structure collections

About this viewer

MolViewer shows 9BS9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.