Crystal structure of DmCfp1 PHD finger bound to H3K4me3. Determined by X-ray diffraction at 1.53 Å resolution. Released 3 Jul 2024.
Explore 9C0O in 3D Show helices and sheets RCSB PDB PDBe
9C0O contains 3 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 61-63 | 3 | |
| β-strand | 64-65 | 2 | 1 |
| β-strand | 74-76 | 3 | 1 |
| β-strand | 77 | 1 | 2 |
| β-strand | 83-85 | 3 | 1 |
| α-helix | 93-96 | 4 | |
| β-strand | 99-101 | 3 | 3 |
| β-strand | 102 | 1 | 2 |
| α-helix | 105-110 | 6 | |
| β-strand | 117-118 | 2 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-4 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CXXC-type zinc finger protein 1 | A | protein | 66 | Drosophila melanogaster | Q9W352 (AlphaFold model) |
| Histone H3.3C | D | protein | 15 | Homo sapiens | Q6NXT2 (AlphaFold model) |
>9C0O_1 CXXC-type zinc finger protein 1 (chains A) GGKQEDQAYCICRSSDCSRFMIGCDGCEEWYHGDCIGITEKEAKHIKQYYCRRCKKENPE LQTIFR
>9C0O_2 Histone H3.3C (chains D) ARTKQTARKSTGGKY
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Water and common crystallization additives (SO4, DMS) are not listed.
Structural insights into an atypical histone binding mechanism by a PHD finger. Gregoire, S., Gregoire, J., Yang, Y. et al. Structure (2024) 32:1498. DOI 10.1016/j.str.2024.06.017 · PubMed
MolViewer shows 9C0O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.