menin mutant M327I in complex with MLL peptide. Determined by X-ray diffraction at 1.46 Å resolution. Released 14 May 2025.
Explore 9C4T in 3D Show helices and sheets RCSB PDB PDBe
9C4T contains 32 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-8 | 4 | |
| α-helix | 11 | 1 | |
| β-strand | 13 | 1 | 1 |
| α-helix | 16-27 | 12 | |
| α-helix | 34-45 | 12 | |
| α-helix | 46-50 | 5 | |
| β-strand | 81 | 1 | 1 |
| α-helix | 83-100 | 18 | |
| α-helix | 103-105 | 3 | |
| α-helix | 115-127 | 13 | |
| α-helix | 143-149 | 7 | |
| α-helix | 154-167 | 14 | |
| β-strand | 174-177 | 4 | 2 |
| β-strand | 182-186 | 5 | 2 |
| α-helix | 188-190 | 3 | |
| β-strand | 192-194 | 3 | 2 |
| α-helix | 203-205 | 3 | |
| α-helix | 212-216 | 5 | |
| α-helix | 220-225 | 6 | |
| β-strand | 228-229 | 2 | 2 |
| α-helix | 232-241 | 10 | |
| β-strand | 246-248 | 3 | 3 |
| β-strand | 251-252 | 2 | 3 |
| α-helix | 254-269 | 16 | |
| α-helix | 277-289 | 13 | |
| α-helix | 291-292 | 2 | |
| α-helix | 296-297 | 2 | |
| α-helix | 298-312 | 15 | |
| α-helix | 319-330 | 12 | |
| α-helix | 334-348 | 15 | |
| α-helix | 358-366 | 9 | |
| α-helix | 367-371 | 5 | |
| α-helix | 372-384 | 13 | |
| α-helix | 403-405 | 3 | |
| α-helix | 407-424 | 18 | |
| α-helix | 434-445 | 12 | |
| α-helix | 449-452 | 4 | |
| β-strand | 456-457 | 2 | 4 |
| β-strand | 550-551 | 2 | 4 |
| α-helix | 556-561 | 6 | |
| α-helix | 562-564 | 3 | |
| α-helix | 572-579 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Menin | A | protein | 489 | Homo sapiens | O00255 (AlphaFold model) |
| Histone-lysine N-methyltransferase 2A | B | protein | 13 | Homo sapiens | Q03164 |
>9C4T_1 Menin (chains A) GGSSSMGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVGL TYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFK DRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAE VTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLE LLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRD EHIYPYIYLAGYHCRNRNVREALQAWADTATVIQDYNYCREDEEIYKEFFEVANDVIPNL LKEAASLLEAGSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVLHVGWATFLVQSLGRF EGQVRQKVRIVSVPAPAASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQ VQMKKQKVS
>9C4T_2 Histone-lysine N-methyltransferase 2A (chains B) SARWRFPARPGTX
| ID | Name | Formula | Copies |
|---|---|---|---|
| PG0 | 2-(2-methoxyethoxy)ethanol | C5 H12 O3 | 1 |
Water and common crystallization additives (SO4, 1PE, PEG) are not listed.
Drug-resistant menin variants retain high binding affinity and interactions with MLL1. Ray, J., Clegg, B., Grembecka, J. et al. J Biol Chem (2024) 300:107777-107777. DOI 10.1016/j.jbc.2024.107777 · PubMed
Other PDB entries of the same protein (UniProt O00255 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9C4T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.