9CRS: Gamma-aminobutyric acid receptor subunit beta-2

Native human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 assembly. Determined by electron microscopy at 2.9 Å resolution. Released 22 Jan 2025.

Method: Electron microscopy
Resolution: 2.9 Å
Organisms: Homo sapiens, Mus musculus
Chains: 9
Atoms: 17,623
Mol. weight: 415.51 kDa
Ligands: ABU, PIO, POV, NAG
Released: 22 Jan 2025

Explore 9CRS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CRS contains 64 α-helices and 131 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
α-helix	28	1
α-helix	35	1
β-strand	36-47	12	1
β-strand	51	1	1
β-strand	56-68	13	1
β-strand	81-83	3	1
α-helix	85-87	3
β-strand	96-98	3	2
β-strand	101	1	1
β-strand	105-106	2	1
β-strand	114-118	5	1
β-strand	123-135	13	1
β-strand	147-156	10	2
β-strand	164-168	5	1
α-helix	171-173	3
β-strand	175-176	2	1
β-strand	190-199	10	2
β-strand	204-215	12	2
α-helix	221-224	4
α-helix	226-235	10
α-helix	236-241	6
α-helix	247-266	20
α-helix	280-303	24
α-helix	304-308	5
α-helix	460-485	26

Chain B: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	13-22	10
β-strand	39-54	16	3
β-strand	59-70	12	3
β-strand	71	1	4
α-helix	73-75	3
β-strand	83-86	4	5
α-helix	88-93	6
β-strand	99-101	3	6
β-strand	104	1	3
β-strand	108-109	2	3
β-strand	113	1	2
β-strand	117	1	3
β-strand	119-122	4	5
β-strand	126	1	4
β-strand	129-138	10	3
β-strand	150-154	5	7
β-strand	157-159	3	6
β-strand	167-171	5	3
α-helix	175-177	3
β-strand	179-181	3	3
β-strand	186	1	3
β-strand	193-199	7	7
β-strand	202-204	3	8
β-strand	209-211	3	8
β-strand	212-213	2	6
β-strand	214-220	7	7
α-helix	226-229	4
α-helix	231-242	12
α-helix	244-246	3
α-helix	252-273	22
α-helix	285-309	25
α-helix	391-417	27

Chain C: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
α-helix	35	1
β-strand	36-47	12	9
β-strand	51	1	9
β-strand	56-68	13	9
α-helix	70-72	3
β-strand	81-82	2	9
α-helix	87-89	3
β-strand	96-98	3	10
β-strand	101-106	6	9
β-strand	114-118	5	9
β-strand	123-135	13	9
α-helix	140-142	3
β-strand	147-148	2	10
β-strand	151-156	6	10
β-strand	164-168	5	9
β-strand	175-176	2	9
β-strand	186-199	14	10
β-strand	204-216	13	10
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-234	8
α-helix	235-240	6
α-helix	247-267	21
α-helix	280-304	25
α-helix	460-486	27

Chain D: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	13-22	10
β-strand	39-50	12	11
β-strand	54	1	12
β-strand	59-61	3	12
β-strand	62-71	10	11
α-helix	73-75	3
β-strand	83-86	4	11
β-strand	99-101	3	13
β-strand	104-106	3	12
β-strand	117-122	6	11
β-strand	126-133	8	11
β-strand	136-138	3	12
α-helix	143-145	3
β-strand	150-154	5	13
β-strand	157-159	3	13
β-strand	167-171	5	11
β-strand	179-181	3	11
β-strand	191-204	14	13
β-strand	209-221	13	13
α-helix	225-226	2
α-helix	227-231	5
α-helix	232-243	12
α-helix	244-246	3
α-helix	252-274	23
α-helix	285-309	25
α-helix	391-415	25

Chain E: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	27-34	8
α-helix	43	1
α-helix	50	1
β-strand	51-58	8	14
β-strand	65-66	2	14
β-strand	71-83	13	14
β-strand	95-98	4	14
α-helix	100-102	3
β-strand	111-113	3	15
β-strand	116-121	6	14
β-strand	129-134	6	14
β-strand	138-150	13	14
β-strand	162-171	10	15
β-strand	179-189	11	14
β-strand	201-214	14	15
β-strand	219-231	13	15
α-helix	234-236	3
α-helix	237-241	5
α-helix	242-251	10
α-helix	252-256	5
α-helix	262-286	25
α-helix	295-321	27
α-helix	411-433	23

Chain I: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	16
β-strand	7	1	17
β-strand	10-12	3	18
β-strand	19-20	2	19
β-strand	22	1	17
β-strand	23-24	2	19
β-strand	25	1	16
β-strand	33-38	6	20
β-strand	45-49	5	20
β-strand	53-54	2	20
α-helix	55	1
β-strand	62-66	5	19
β-strand	70-75	6	19
α-helix	80-82	3
β-strand	85-90	6	20
β-strand	96-97	2	20
β-strand	101	1	20
β-strand	102-104	3	18

Chain J: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	21
β-strand	10-12	3	22
β-strand	17-25	9	21
β-strand	34-39	6	23
β-strand	45-52	8	23
β-strand	57-60	4	23
α-helix	62-64	3
β-strand	65	1	21
β-strand	68-73	6	21
β-strand	78-84	7	21
α-helix	88-90	3
β-strand	93-98	6	23
β-strand	108	1	23
β-strand	112-113	2	23
β-strand	114-116	3	22

Chain K: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	24
α-helix	7-9	3
β-strand	10-11	2	25
β-strand	18-25	8	24
α-helix	29-31	3
β-strand	34-39	6	26
β-strand	45-52	8	26
β-strand	57-60	4	26
α-helix	62-64	3
β-strand	68-73	6	24
β-strand	78-83	6	24
β-strand	93-99	7	26
β-strand	105-108	4	26
β-strand	112-113	2	26
β-strand	114-115	2	25

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit beta-2	A, C	protein	488	Homo sapiens	P47870 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-1	B, D	protein	429	Homo sapiens	P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	E	protein	436	Homo sapiens	P18507 (AlphaFold model)
Kappa Fab_1F4 Light Chain	I, L	protein	213	Mus musculus
IgG2b Fab_1F4 Heavy Chain	J, K	protein	454	Mus musculus

Sequence of entity 1 (A, C), FASTA

>9CRS_1 Gamma-aminobutyric acid receptor subunit beta-2 (chains A, C)
QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLT
MYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTK
IELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYA
LVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSP
TRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKA
GLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNI
VYWLYYVN

Sequence of entity 2 (B, D), FASTA

>9CRS_2 Gamma-aminobutyric acid receptor subunit alpha-1 (chains B, D)
QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEY
TIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLR
ITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVV
VAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSA
LIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLA
TIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREP
QLKAPTPHQ

Sequence of entity 3 (E), FASTA

>9CRS_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains E)
QKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVN
SIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKAD
AHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIV
YQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQT
YIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV
SVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQM
NNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPT
AFCLFNLVYWVSYLYL

Sequence of entity 4 (I, L), FASTA

>9CRS_4 Kappa Fab_1F4 Light Chain (chains I, L)
NIVMTQSPKSMSMSVGERVTLSCKASEYVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTIGSVQAEDLADYHCGQSYSYPTFGAGTKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 5 (J, K), FASTA

>9CRS_5 IgG2b Fab_1F4 Heavy Chain (chains J, K)
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMYWVKQRPEQGLEWIGRIDPANGDTKY
DPKFQGKATITTDTFSNTAYLQLSSLTSEDTAVYYCARKGLRWAMDYWGQGTSVTVSTAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN
LEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHR
EDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPP
PAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMK
TSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Ligands and cofactors

ID	Name	Formula	Copies
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	2
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Resolving native GABA A receptor structures from the human brain. Zhou, J., Noviello, C.M., Teng, J. et al. Nature (2025) 638:562-568. DOI 10.1038/s41586-024-08454-1 · PubMed

Other PDB entries of the same protein (UniProt P47870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X3T 2.55 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol
8VRN 2.57 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ
8SGO 2.65 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone…
8SID 2.71 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
8VQY 2.82 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus methaqualone
6X40 2.86 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus picrotoxin
8DD2 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus Zolpidem
8DD3 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus DMCM
6X3X 2.92 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus diazepam
9DRX 2.95 Å, Human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 subtype in complex with GABA…
8SI9 2.98 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
7T0W 3.0 Å, Complex of GABA-A synaptic receptor with autoimmune antibody Fab115

Browse structure collections

About this viewer

MolViewer shows 9CRS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.