9CU8: TNFR2 TNFR2_mb1 Complex

Crystal Structure of TNFR2 TNFR2_mb1 Complex. Determined by X-ray diffraction at 1.96 Å resolution. Released 4 Dec 2024.

Method: X-ray diffraction
Resolution: 1.96 Å
Organisms: synthetic construct, Homo sapiens
Chains: 2
Atoms: 2,363
Mol. weight: 32.08 kDa
Released: 4 Dec 2024

Explore 9CU8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CU8 contains 20 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	3-29	27
α-helix	33-55	23
α-helix	57-59	3
α-helix	60-74	15
α-helix	79-104	26

Chain B: 15 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	96-97	2
β-strand	100	1	1
α-helix	101-103	3
β-strand	112-115	4	1
β-strand	120-123	4	1
α-helix	124	1
β-strand	125	1	2
α-helix	126	1
β-strand	129-133	5	3
α-helix	140-141	2
β-strand	142-145	4	3
α-helix	146-147	2
β-strand	150-151	2	4
β-strand	156	1	2
α-helix	161	1
β-strand	162-163	2	4
α-helix	164-169	6
β-strand	173-176	4	5
β-strand	179	1	6
β-strand	182	1	6
β-strand	185-187	3	5
α-helix	188-189	2
β-strand	192-197	6	7
β-strand	202-207	6	7
α-helix	208-209	2
β-strand	211	1	8
α-helix	212	1
β-strand	215-219	5	9
β-strand	222	1	10
β-strand	225	1	10
β-strand	228-231	4	9
α-helix	232-233	2
β-strand	236-237	2	11
β-strand	242	1	8
α-helix	245-247	3
β-strand	248-249	2	11
α-helix	250-252	3
β-strand	256-258	3	12
β-strand	261	1	13
β-strand	264	1	13
α-helix	265-266	2
β-strand	267-268	2	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNFR2_mb1	A	protein	106	synthetic construct
Tumor necrosis factor receptor superfamily member 1B	B	protein	190	Homo sapiens	P20333 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9CU8_1 TNFR2_mb1 (chains A)
LNPEQVAKIGAAIDAGRKYLDAKIEEAKKTLTLRTAQALLVIRSQYERAVDTLFTDPSAA
EKELAATLATIDRLLKEHPELAAEIKAFIRSTMAEIRALLAASLAA

Sequence of entity 2 (B), FASTA

>9CU8_2 Tumor necrosis factor receptor superfamily member 1B (chains B)
LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDST
YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRK
CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTS
TSPTRSMAPG

Primary citation

Target-conditioned diffusion generates potent TNFR superfamily antagonists and agonists. Glogl, M., Krishnakumar, A., Ragotte, R.J. et al. Science (2024) 386:1154-1161. DOI 10.1126/science.adp1779 · PubMed

Other PDB entries of the same protein (UniProt P20333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CA9 2.3 Å, Structure of tnf receptor associated factor 2 in complex with a peptide from tnf-R2
9LQI 2.95 Å, Structure of Nanobody-161 in complex of Tumor necrosis factor receptor 2 (TNFR2)
3ALQ 3.0 Å, Crystal structure of TNF-TNFR2 complex
8HLB 3.63 Å, Cryo-EM structure of biparatopic antibody Bp109-92 in complex with TNFR2
9LFL 3.73 Å, Cryo-EM structure of linker-extended biparatopic antibody BA1-GP4 in complex with TNFR2

Browse structure collections

About this viewer

MolViewer shows 9CU8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.