9DDP: E. coli TonB-ExbBD TonB
E. coli TonB-ExbBD TonB bound to ExbB chain E. Determined by electron microscopy at 3.16 Å resolution. Released 9 Jul 2025.
- Method
- Electron microscopy
- Resolution
- 3.16 Å
- Organism
- Escherichia coli
- Chains
- 8
- Atoms
- 9,072
- Mol. weight
- 196.38 kDa
- Released
- 9 Jul 2025
Explore 9DDP in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9DDP contains 39 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-18 | 6 | |
| α-helix | 21-62 | 42 | |
| α-helix | 68-75 | 8 | |
| α-helix | 83-97 | 15 | |
| α-helix | 104-126 | 23 | |
| α-helix | 130-162 | 33 | |
| α-helix | 167-232 | 66 | |
Chain B: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-18 | 7 | |
| α-helix | 21-62 | 42 | |
| α-helix | 68-75 | 8 | |
| α-helix | 85-96 | 12 | |
| α-helix | 104-126 | 23 | |
| α-helix | 130-162 | 33 | |
| α-helix | 167-232 | 66 | |
Chain C: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-18 | 7 | |
| α-helix | 21-62 | 42 | |
| α-helix | 68-75 | 8 | |
| α-helix | 83-97 | 15 | |
| α-helix | 104-126 | 23 | |
| α-helix | 130-162 | 33 | |
| α-helix | 167-230 | 64 | |
Chain D: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-17 | 4 | |
| α-helix | 21-62 | 42 | |
| α-helix | 68-75 | 8 | |
| α-helix | 83-97 | 15 | |
| α-helix | 105-126 | 22 | |
| α-helix | 130-162 | 33 | |
| α-helix | 167-231 | 65 | |
Chain E: 8 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-18 | 7 | |
| α-helix | 21-62 | 42 | |
| α-helix | 68-75 | 8 | |
| α-helix | 83-97 | 15 | |
| α-helix | 105-126 | 22 | |
| α-helix | 130-162 | 33 | |
| α-helix | 167-169 | 3 | |
| α-helix | 171-230 | 60 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-23 | 13 | |
Chain Y: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 21-40 | 20 | |
Chain Z: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 23-37 | 15 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Biopolymer transport protein ExbB | A, B, C, D, E | protein | 244 | Escherichia coli | P0ABU7 (AlphaFold model) |
| Protein TonB | F | protein | 261 | Escherichia coli | P02929 (AlphaFold model) |
| Biopolymer transport protein ExbD | Y, Z | protein | 163 | Escherichia coli | P0ABV2 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E), FASTA
>9DDP_1 Biopolymer transport protein ExbB (chains A, B, C, D, E)
MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQ
LLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIKERTSFRLERRVA
AVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLA
TAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLDLEASAAAHPVRVAQK
LRAG
Sequence of entity 2 (F), FASTA
>9DDP_2 Protein TonB (chains F)
MTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQPISVTMVTPADLEPPQA
VQPPPEPVVEPEPEPEPIPEPPKEAPVVIEKPKPKPKPKPKPVKKVQEQPKRDVKPVESR
PASPFENTAPARLTSSTATAATSKPVTSVASGPRALSRNQPQYPARAQALRIEGQVKVKF
DVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGTTEIQG
GGSENLYFQGGSAWSHPQFEK
Sequence of entity 3 (Y, Z), FASTA
>9DDP_3 Biopolymer transport protein ExbD (chains Y, Z)
MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRP
EKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMD
TLHQAGYLKIGLVGEETAKAKENLYFQGNAGSGHHHHHHHHHH
Primary citation
Cryo-EM structures of the E. coli Ton and Tol motor complexes. Celia, H., Botos, I., Ghirlando, R. et al. Nat Commun (2025) 16:5506-5506. DOI 10.1038/s41467-025-61286-z · PubMed
Other PDB entries of the same protein (UniProt P0ABU7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5SV0 2.6 Å, Structure of the ExbB/ExbD complex from E. coli at pH 7.0
- 9DDO 2.8 Å, E. coli TonB-ExbBD TonB bound to ExbB chain C
- 5ZFP 2.84 Å, Structure of the ExbB/ExbD hexameric complex
- 9DDQ 3.19 Å, E. coli TonB-ExbBD TonB bound to ExbB chain A
- 6TYI 3.3 Å, ExbB-ExbD complex in MSP1E3D1 nanodisc
- 5SV1 3.5 Å, Structure of the ExbB/ExbD complex from E. coli at pH 4.5
- 5ZFU 6.7 Å, Structure of the ExbB/ExbD hexameric complex (ExbB6ExbD3TM)
- 5ZFV 7.1 Å, Structure of the ExbB/ExbD pentameric complex (ExbB5ExbD1TM)
Browse structure collections
About this viewer
MolViewer shows 9DDP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.