9DFF: G1 domain of human aggrecan

G1 domain of human aggrecan bound to hyaluronan. Determined by X-ray diffraction at 2.59 Å resolution. Released 30 Apr 2025.

Method: X-ray diffraction
Resolution: 2.59 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,327
Mol. weight: 79.44 kDa
Ligands: NAG
Released: 30 Apr 2025

Explore 9DFF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9DFF contains 18 α-helices and 60 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	32	1	1
β-strand	39-42	4	2
β-strand	47-49	3	3
β-strand	52	1	1
β-strand	72-79	8	2
β-strand	82-90	9	2
β-strand	93-96	4	2
α-helix	98-100	3
β-strand	104-105	2	3
β-strand	115	1	1
β-strand	118-120	3	3
α-helix	125-127	3
β-strand	129-137	9	2
β-strand	140-151	12	2
β-strand	153-157	5	4
β-strand	166	1	5
α-helix	168-176	9
β-strand	181-182	2	4
α-helix	183-184	2
α-helix	185-193	9
β-strand	202-203	2	4
β-strand	208-213	6	4
β-strand	229-235	7	4
β-strand	242	1	5
β-strand	243-248	6	4
β-strand	255-258	4	6
β-strand	264	1	7
α-helix	266-275	10
β-strand	279-280	2	6
α-helix	281-282	2
α-helix	283-291	9
β-strand	300-301	2	6
β-strand	307-311	5	6
β-strand	324-327	4	6
β-strand	331	1	8
β-strand	335	1	8
α-helix	337-339	3
β-strand	344	1	7
β-strand	345-349	5	6

Chain B: 9 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	32	1	9
β-strand	39-42	4	10
β-strand	47-49	3	11
β-strand	52	1	9
β-strand	72-78	7	10
β-strand	83-90	8	10
β-strand	93-96	4	10
α-helix	98-100	3
β-strand	104-105	2	11
β-strand	115	1	9
β-strand	118-120	3	11
α-helix	125-127	3
β-strand	129-136	8	10
β-strand	142-151	10	10
β-strand	153-157	5	12
β-strand	166	1	13
α-helix	168-176	9
β-strand	181-182	2	12
α-helix	183-184	2
α-helix	185-193	9
β-strand	202-203	2	12
β-strand	208-213	6	12
β-strand	229-235	7	12
β-strand	242	1	13
β-strand	243-248	6	12
β-strand	255-258	4	14
β-strand	264	1	15
α-helix	266-275	10
β-strand	279-280	2	14
α-helix	281-282	2
α-helix	283-291	9
β-strand	300-301	2	14
β-strand	307-311	5	14
β-strand	324-327	4	14
β-strand	331	1	16
β-strand	335	1	16
α-helix	337-339	3
β-strand	344	1	15
β-strand	345-349	5	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aggrecan core protein	A, B	protein	335	Homo sapiens	P16112 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9DFF_1 Aggrecan core protein (chains A, B)
GPGSETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWS
RVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVM
HGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSAIIATPEQLQAAYEDGF
HQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNETYDVYCFAEEMEGEVF
YATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAGWLADRSVRYPISKARP
NCGGNLLGVRTVYVHANQTGYPDPSSRYDAICYTG

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6

Primary citation

Aggrecan immobilizes to perineuronal nets through hyaluronan-dependent and hyaluronan-independent binding activities. Otsuka, M.Y., Essel, L.B., Sinha, A. et al. J Biol Chem (2025) 301:108525-108525. DOI 10.1016/j.jbc.2025.108525 · PubMed

Other PDB entries of the same protein (UniProt P16112 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4MD4 1.95 Å, Immune Receptor
7RDV 2.9 Å, TFH TCR bound to MHC Class II IAd presenting aggrecan epitope
9DFT 3.5 Å, G1 domain of human aggrecan

Browse structure collections

About this viewer

MolViewer shows 9DFF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.