9DUN: Human LAS1L-NOL9 complex
Human LAS1L-NOL9 complex. Determined by electron microscopy at 3.32 Å resolution. Released 30 Apr 2025.
- Method
- Electron microscopy
- Resolution
- 3.32 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 6,672
- Mol. weight
- 198.3 kDa
- Released
- 30 Apr 2025
Explore 9DUN in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9DUN contains 37 α-helices and 25 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 10 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 302-303 | 2 | 1 |
| α-helix | 313-326 | 14 | |
| β-strand | 330-334 | 5 | 1 |
| β-strand | 347-353 | 7 | 1 |
| α-helix | 361-363 | 3 | |
| β-strand | 370-373 | 4 | 1 |
| α-helix | 386-394 | 9 | |
| β-strand | 403-406 | 4 | 1 |
| α-helix | 419-423 | 5 | |
| α-helix | 518-527 | 10 | |
| α-helix | 528-531 | 4 | |
| α-helix | 546-547 | 2 | |
| β-strand | 556-559 | 4 | 2 |
| α-helix | 567-569 | 3 | |
| β-strand | 576-581 | 6 | 2 |
| β-strand | 608-613 | 6 | 2 |
| β-strand | 622-624 | 3 | 2 |
| α-helix | 629-632 | 4 | |
| β-strand | 637-640 | 4 | 2 |
| α-helix | 647-650 | 4 | |
Chain B: 10 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 301-303 | 3 | 3 |
| α-helix | 312-326 | 15 | |
| β-strand | 330-334 | 5 | 3 |
| β-strand | 347-350 | 4 | 3 |
| β-strand | 352-353 | 2 | 3 |
| β-strand | 370-373 | 4 | 3 |
| α-helix | 386-394 | 9 | |
| β-strand | 403-406 | 4 | 3 |
| β-strand | 430 | 1 | 3 |
| α-helix | 513-516 | 4 | |
| α-helix | 520-528 | 9 | |
| α-helix | 529-531 | 3 | |
| α-helix | 546-547 | 2 | |
| β-strand | 549 | 1 | 4 |
| β-strand | 556-559 | 4 | 5 |
| α-helix | 567-569 | 3 | |
| α-helix | 570-573 | 4 | |
| β-strand | 577-578 | 2 | 6 |
| β-strand | 579 | 1 | 5 |
| β-strand | 609-613 | 5 | 6 |
| β-strand | 622-624 | 3 | 6 |
| α-helix | 629-632 | 4 | |
| β-strand | 637-640 | 4 | 5 |
| α-helix | 647-650 | 4 | |
Chain C: 8 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 53-59 | 7 | |
| α-helix | 65-68 | 4 | |
| α-helix | 75-78 | 4 | |
| α-helix | 86-103 | 18 | |
| α-helix | 112-125 | 14 | |
| α-helix | 154-159 | 6 | |
| α-helix | 163-165 | 3 | |
| α-helix | 166-183 | 18 | |
Chain D: 8 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 50-57 | 8 | |
| α-helix | 65-68 | 4 | |
| α-helix | 75-78 | 4 | |
| α-helix | 86-101 | 16 | |
| α-helix | 108-125 | 18 | |
| α-helix | 149-160 | 12 | |
| α-helix | 163-165 | 3 | |
| α-helix | 166-183 | 18 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 639-641 | 3 | |
Chain F: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 639 | 1 | 4 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Polynucleotide 5'-hydroxyl-kinase NOL9 | A, B | protein | 602 | Homo sapiens | Q5SY16 (AlphaFold model) |
| Ribosomal biogenesis protein LAS1L | C, D | protein | 202 | Homo sapiens | Q9Y4W2 (AlphaFold model) |
| Ribosomal biogenesis protein LAS1L | E, F | protein | 71 | Homo sapiens | Q9Y4W2 (AlphaFold model) |
Sequence of entity 1 (A, B), FASTA
>9DUN_1 Polynucleotide 5'-hydroxyl-kinase NOL9 (chains A, B)
SNSASSCHRPLLIPPVRPVGPGRALLLLPVEQGFTFSGICRVTCLYGQVQVFGFTISQGQ
PAQDIFSVYTHSCLSIHALHYSQPEKSKKELKREARNLLKSHLNLDDRRWSMQNFSPQCS
IVLLEHLKTATVNFITSYPGSSYIFVQESPTPQIKPEYLALRSVGIRREKKRKGLQLTES
TLSALEELVNVSCEEVDGCPVILVCGSQDVGKSTFNRYLINHLLNSLPCVDYLECDLGQT
EFTPPGCISLLNITEPVLGPPFTHLRTPQKMVYYGKPSCKNNYENYIDIVKYVFSAYKRE
SPLIVNTMGWVSDQGLLLLIDLIRLLSPSHVVQFRSDHSKYMPDLTPQYVDDMDGLYTKS
KTKMRNRRFRLAAFADALEFADEEKESPVEFTGHKLIGVYTDFAFRITPRNRESHNKILR
DLSILSYLSQLQPPMPKPLSPLHSLTPYQVPFNAVALRITHSDVAPTHILYAVNASWVGL
CKIQDDVRGYTNGPILLAQTPICDCLGFGICRGIDMEKRLYHILTPVPPEELRTVNCLLV
GAIAIPHCVLKCQRGIEGTVPYVTTDYNFKLPGASEKIGAREPEEAHKEKPYRRPKFCRK
MK
Sequence of entity 2 (C, D), FASTA
>9DUN_2 Ribosomal biogenesis protein LAS1L (chains C, D)
SNMSWESGAGPGLGSQGMDLVWSAWYGKCVKGKGSLPLSAHGIVVAWLSRAEWDQVTVYL
FCDDHKLQRYALNRITVWRSRSGNELPLAVASTADLIRCKLLDVTGGLGTDELRLLYGMA
LVRFVNLISERKTKFAKVPLKCLAQEVNIPDWIVDLRHELTHKKMPHINDCRRGCYFVLD
WLQKTYWCRQLENSLRETWELE
Sequence of entity 3 (E, F), FASTA
>9DUN_3 Ribosomal biogenesis protein LAS1L (chains E, F)
SNGQESPTAENARLLAQKRGALQGSAWQVSSEDVRWDTFPLGRMPGQTEDPAELMLENYD
TMYLLDQPVLE
Primary citation
Molecular insights into the overall architecture of human rixosome. Huang, J., Tong, L. Nat Commun (2025) 16:3288-3288. DOI 10.1038/s41467-025-58732-3 · PubMed
Other PDB entries of the same protein (UniProt Q5SY16 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 26LK 3.4 Å, Cryo-EM structure of human LAS1L-NOL9 complex
- 10RR 3.5 Å, Human RNase PNK bound to AMPPNP ligand + rCAA in PNK active site
- 10RN 3.6 Å, Human RNase PNK bound to ATPyS ligand
Browse structure collections
About this viewer
MolViewer shows 9DUN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.